Sequence 1: | NP_476702.1 | Gene: | rk / 34819 | FlyBaseID: | FBgn0003255 | Length: | 1360 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001002059.1 | Gene: | lum / 415149 | ZFINID: | ZDB-GENE-040625-24 | Length: | 344 | Species: | Danio rerio |
Alignment Length: | 339 | Identity: | 91/339 - (26%) |
---|---|---|---|
Similarity: | 149/339 - (43%) | Gaps: | 72/339 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 150 KHCHCTGSLEVLRLSCRGIGILAVPVNLPNEVVVLDLGNNNLTKLEANSFFMAPNLEELTLSDNS 214
Fly 215 IIN--MDPNAFYGLAKLKRLSLQNCGLKSLPPQSFQGLAQLTSLQLNGNALVSLDGDCLGHLQKL 277
Fly 278 RTLRLEGNLFYRIPTNALAGLRTLEALNLGSNLLTIIN-DEDFPRMPNLIVLLLKRNQIMKISAG 341
Fly 342 ALKNLTALKVLELDDNLISSLPEG-LSKLSQLQELSITSNRLRWINDTELPRSMQMLDMRANPLS 405
Fly 406 TISPGAFRGMSKLRKLILSDVRTLRSFPELEACHALEILKLDRAGIQEVP----ANLCR-QTP-- 463
Fly 464 --RLKSLELKTNSL 475 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
rk | NP_476702.1 | leucine-rich repeat | 158..179 | CDD:275380 | 2/20 (10%) |
LRR_RI | 180..>383 | CDD:238064 | 59/206 (29%) | ||
leucine-rich repeat | 183..204 | CDD:275380 | 7/20 (35%) | ||
LRR_8 | 203..263 | CDD:290566 | 12/61 (20%) | ||
leucine-rich repeat | 205..228 | CDD:275380 | 6/24 (25%) | ||
leucine-rich repeat | 229..252 | CDD:275380 | 5/22 (23%) | ||
LRR_8 | 252..311 | CDD:290566 | 16/58 (28%) | ||
leucine-rich repeat | 253..276 | CDD:275380 | 4/22 (18%) | ||
leucine-rich repeat | 277..300 | CDD:275380 | 9/22 (41%) | ||
LRR_8 | 299..359 | CDD:290566 | 16/60 (27%) | ||
leucine-rich repeat | 301..324 | CDD:275380 | 6/23 (26%) | ||
leucine-rich repeat | 325..348 | CDD:275380 | 6/22 (27%) | ||
LRR_RI | 327..567 | CDD:238064 | 47/159 (30%) | ||
leucine-rich repeat | 349..371 | CDD:275380 | 11/22 (50%) | ||
LRR_8 | 370..425 | CDD:290566 | 14/54 (26%) | ||
leucine-rich repeat | 372..393 | CDD:275380 | 6/20 (30%) | ||
leucine-rich repeat | 394..415 | CDD:275380 | 4/20 (20%) | ||
leucine-rich repeat | 418..486 | CDD:275380 | 21/67 (31%) | ||
leucine-rich repeat | 441..464 | CDD:275378 | 9/31 (29%) | ||
LRR_8 | 487..545 | CDD:290566 | |||
leucine-rich repeat | 487..510 | CDD:275380 | |||
leucine-rich repeat | 511..534 | CDD:275380 | |||
LRR_8 | 533..589 | CDD:290566 | |||
leucine-rich repeat | 535..558 | CDD:275380 | |||
leucine-rich repeat | 559..580 | CDD:275380 | |||
7tm_4 | 764..>892 | CDD:304433 | |||
7tm_1 | 770..1017 | CDD:278431 | |||
lum | NP_001002059.1 | LRRNT | 41..68 | CDD:279764 | 4/26 (15%) |
LRR_RI | 58..274 | CDD:238064 | 72/268 (27%) | ||
LRR_8 | 70..132 | CDD:290566 | 15/61 (25%) | ||
leucine-rich repeat | 72..95 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 96..121 | CDD:275380 | 6/24 (25%) | ||
LRR_8 | 121..177 | CDD:290566 | 21/82 (26%) | ||
leucine-rich repeat | 122..142 | CDD:275380 | 6/35 (17%) | ||
leucine-rich repeat | 143..166 | CDD:275380 | 11/33 (33%) | ||
LRR_8 | 166..247 | CDD:290566 | 28/83 (34%) | ||
leucine-rich repeat | 167..191 | CDD:275380 | 6/23 (26%) | ||
leucine-rich repeat | 192..212 | CDD:275380 | 6/22 (27%) | ||
leucine-rich repeat | 213..236 | CDD:275380 | 11/22 (50%) | ||
LRR_8 | 235..292 | CDD:290566 | 22/83 (27%) | ||
leucine-rich repeat | 237..261 | CDD:275380 | 10/44 (23%) | ||
leucine-rich repeat | 282..311 | CDD:275380 | 9/31 (29%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |