DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rk and LUM

DIOPT Version :9

Sequence 1:NP_476702.1 Gene:rk / 34819 FlyBaseID:FBgn0003255 Length:1360 Species:Drosophila melanogaster
Sequence 2:NP_002336.1 Gene:LUM / 4060 HGNCID:6724 Length:338 Species:Homo sapiens


Alignment Length:288 Identity:83/288 - (28%)
Similarity:117/288 - (40%) Gaps:98/288 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   323 PNLIVLLLKRNQIMKISAGALKNLTALKVLELDDNLI-SSLPEG--LSKLSQLQELSITSNRLRW 384
            |.:..|.|:.|||..|...|.:|:|.|:.|.||.||: :|..:|  .|||.||::|.|..|.|  
Human    66 PGIKYLYLRNNQIDHIDEKAFENVTDLQWLILDHNLLENSKIKGRVFSKLKQLKKLHINHNNL-- 128

  Fly   385 INDTE----LPRSMQMLDMRANPLSTISPGAFRGMSKLRKLILSDVRTLRSFPELEACHALEILK 445
               ||    ||:|::.|.:..|.::.:  |:|.|:..|            :|             
Human   129 ---TESVGPLPKSLEDLQLTHNKITKL--GSFEGLVNL------------TF------------- 163

  Fly   446 LDRAGIQEVPANLCRQTPRLKSLELKTNSLKRIPNLSSCRDLRLLDLSSNQIEKIQGKPFNGLKQ 510
                                  :.|:.|.||                     |......|.|||.
Human   164 ----------------------IHLQHNRLK---------------------EDAVSAAFKGLKS 185

  Fly   511 LNDLLLSYNRIKALPQDAFQGIP-KLQLLDLEGNEISYIHKEAFSGFTALEDLNLGNNIFPELPE 574
            |..|.||:|:|..||    .|:| .|..|.|:.|:||.|..|.|..|.||:.|.|.:|   ||.:
Human   186 LEYLDLSFNQIARLP----SGLPVSLLTLYLDNNKISNIPDEYFKRFNALQYLRLSHN---ELAD 243

  Fly   575 SGL-------RALLHLKTFNNPKLREFP 595
            ||:       .:|:.|....| ||:..|
Human   244 SGIPGNSFNVSSLVELDLSYN-KLKNIP 270

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
rkNP_476702.1 leucine-rich repeat 158..179 CDD:275380
LRR_RI 180..>383 CDD:238064 26/62 (42%)
leucine-rich repeat 183..204 CDD:275380
LRR_8 203..263 CDD:290566
leucine-rich repeat 205..228 CDD:275380
leucine-rich repeat 229..252 CDD:275380
LRR_8 252..311 CDD:290566
leucine-rich repeat 253..276 CDD:275380
leucine-rich repeat 277..300 CDD:275380
LRR_8 299..359 CDD:290566 15/35 (43%)