Sequence 1: | NP_476702.1 | Gene: | rk / 34819 | FlyBaseID: | FBgn0003255 | Length: | 1360 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001124067.2 | Gene: | tlr5b / 403139 | ZFINID: | ZDB-GENE-040219-15 | Length: | 881 | Species: | Danio rerio |
Alignment Length: | 582 | Identity: | 138/582 - (23%) |
---|---|---|---|
Similarity: | 223/582 - (38%) | Gaps: | 160/582 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 159 EVLRLS--CRGIGILAVPVN--------LPNEVVVLDLGNNNLTKLEANSFFMAPNLE------- 206
Fly 207 ------------------ELTLSDNSIINMDPNAFYGLAKLKRLSLQNCGL-------------- 239
Fly 240 ------------KSLPPQS-FQGLAQLTSLQLNGNALVSL-DGDCLG----HLQKLR-------- 278
Fly 279 ---------------------TLRLEGNLFYRIPT----NALAGLRTLEAL------NLGSNL-L 311
Fly 312 TIINDED-----------------------------FPRMPNLIVLLLKRNQIMKISAGALKNLT 347
Fly 348 ALKVLELDDNLISSLPEGL-SKLSQLQELSITSNRLRWINDTE---LPRSMQMLDMRANPLSTIS 408
Fly 409 PGAFRGMSKLRKLIL--SDVRTLRSFPELEACHALEILKLDRAGIQEVP--ANLCRQTPRLKSLE 469
Fly 470 LKTNSLKRIPN-----LSSCRDLRLLDLSSNQIEKIQGKPFN---GLKQLNDLLLSYNRIKALPQ 526
Fly 527 DAFQGIPKLQLLDLEGNEISYIHKEAFSGFTALEDLNLGNNIFPELPESGLRALLHLKTFNN 588 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
rk | NP_476702.1 | leucine-rich repeat | 158..179 | CDD:275380 | 8/29 (28%) |
LRR_RI | 180..>383 | CDD:238064 | 70/329 (21%) | ||
leucine-rich repeat | 183..204 | CDD:275380 | 6/20 (30%) | ||
LRR_8 | 203..263 | CDD:290566 | 21/111 (19%) | ||
leucine-rich repeat | 205..228 | CDD:275380 | 8/47 (17%) | ||
leucine-rich repeat | 229..252 | CDD:275380 | 9/49 (18%) | ||
LRR_8 | 252..311 | CDD:290566 | 22/103 (21%) | ||
leucine-rich repeat | 253..276 | CDD:275380 | 7/27 (26%) | ||
leucine-rich repeat | 277..300 | CDD:275380 | 11/55 (20%) | ||
LRR_8 | 299..359 | CDD:290566 | 22/95 (23%) | ||
leucine-rich repeat | 301..324 | CDD:275380 | 8/58 (14%) | ||
leucine-rich repeat | 325..348 | CDD:275380 | 9/22 (41%) | ||
LRR_RI | 327..567 | CDD:238064 | 72/255 (28%) | ||
leucine-rich repeat | 349..371 | CDD:275380 | 6/22 (27%) | ||
LRR_8 | 370..425 | CDD:290566 | 14/59 (24%) | ||
leucine-rich repeat | 372..393 | CDD:275380 | 7/23 (30%) | ||
leucine-rich repeat | 394..415 | CDD:275380 | 3/20 (15%) | ||
leucine-rich repeat | 418..486 | CDD:275380 | 17/76 (22%) | ||
leucine-rich repeat | 441..464 | CDD:275378 | 4/24 (17%) | ||
LRR_8 | 487..545 | CDD:290566 | 24/60 (40%) | ||
leucine-rich repeat | 487..510 | CDD:275380 | 10/25 (40%) | ||
leucine-rich repeat | 511..534 | CDD:275380 | 8/22 (36%) | ||
LRR_8 | 533..589 | CDD:290566 | 16/56 (29%) | ||
leucine-rich repeat | 535..558 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 559..580 | CDD:275380 | 5/20 (25%) | ||
7tm_4 | 764..>892 | CDD:304433 | |||
7tm_1 | 770..1017 | CDD:278431 | |||
tlr5b | NP_001124067.2 | leucine-rich repeat | 55..78 | CDD:275380 | 7/22 (32%) |
leucine-rich repeat | 79..103 | CDD:275380 | 1/23 (4%) | ||
LRR_8 | 102..164 | CDD:290566 | 13/61 (21%) | ||
leucine-rich repeat | 104..127 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 128..153 | CDD:275380 | 5/24 (21%) | ||
leucine-rich repeat | 154..178 | CDD:275380 | 4/23 (17%) | ||
leucine-rich repeat | 179..236 | CDD:275380 | 9/56 (16%) | ||
LRR_RI | <224..478 | CDD:238064 | 57/259 (22%) | ||
LRR_8 | 298..356 | CDD:290566 | 14/57 (25%) | ||
leucine-rich repeat | 300..323 | CDD:275380 | 1/22 (5%) | ||
leucine-rich repeat | 324..347 | CDD:275380 | 9/22 (41%) | ||
LRR_8 | 346..404 | CDD:290566 | 15/58 (26%) | ||
leucine-rich repeat | 348..371 | CDD:275380 | 6/22 (27%) | ||
leucine-rich repeat | 372..395 | CDD:275380 | 7/23 (30%) | ||
LRR_8 | 394..451 | CDD:290566 | 14/61 (23%) | ||
leucine-rich repeat | 396..417 | CDD:275380 | 3/22 (14%) | ||
leucine-rich repeat | 441..482 | CDD:275380 | 7/40 (18%) | ||
leucine-rich repeat | 494..520 | CDD:275380 | 10/25 (40%) | ||
LRR_8 | 520..577 | CDD:290566 | 21/58 (36%) | ||
leucine-rich repeat | 521..544 | CDD:275380 | 8/22 (36%) | ||
leucine-rich repeat | 545..563 | CDD:275380 | 6/17 (35%) | ||
leucine-rich repeat | 567..587 | CDD:275380 | 5/19 (26%) | ||
LRRCT | 596..645 | CDD:214507 | 1/1 (100%) | ||
TIR | 712..846 | CDD:214587 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |