DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rk and chad

DIOPT Version :9

Sequence 1:NP_476702.1 Gene:rk / 34819 FlyBaseID:FBgn0003255 Length:1360 Species:Drosophila melanogaster
Sequence 2:NP_957357.1 Gene:chad / 394038 ZFINID:ZDB-GENE-040426-1130 Length:363 Species:Danio rerio


Alignment Length:403 Identity:103/403 - (25%)
Similarity:163/403 - (40%) Gaps:96/403 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 CHCTGSLEVLRLSCRGIGILAVPVNLPNEVVVLDLGNNNLTKLEANSFFMAPNLEELTLSDNSII 216
            |||.|.|:  .:.|..:|:..:| .:.....:|:|..|||..|....|.....|..|.|....|.
Zfish    31 CHCHGDLQ--HVICDNVGLKKIP-RISEATRLLNLQRNNLGNLPTGGFSEMKGLISLHLQHCQIR 92

  Fly   217 NMDPNAFYGLAKLKRLSLQNCGLKSLPPQSFQGLAQLTSLQLNGNALVSLDGDCLGHLQKLRTLR 281
            .:...||.||.||..|.|.:..:.::.|.:|:.|.:||.|.|:||.:.||               
Zfish    93 ELSGQAFKGLNKLIYLYLSDNEISTIKPGAFEDLTELTYLYLDGNQITSL--------------- 142

  Fly   282 LEGNLFYRIPTNALAGLRTLEALNLGSNLLTIINDEDFPRMPNLIVLLLKRNQIMKISAGALKNL 346
                     |....:.:..|..|.|.:|.|..:....|....:|..|.:..|::..|..|:|..:
Zfish   143 ---------PKGIFSPMINLFILQLNNNKLRELQPGTFKGAKDLRWLYMSGNELSSIQPGSLDEV 198

  Fly   347 TALKVLELDDNLISSLP-EGLSKLSQLQELSITSNRLRWINDTELPRSMQMLDMRANPLSTISPG 410
            ..|.:|.||.|.:|:.| ..:|||..::||:::.                      ||||.|...
Zfish   199 ENLAILTLDQNNLSTYPLLAMSKLRVVEELNLSK----------------------NPLSLIPDH 241

  Fly   411 AFRGMSK-LRKLILSDVRTLRSFPELEACHALEILKLDRAGIQEVPANLCRQTPRLKSLELKTNS 474
            |||...: :.||.|:|:             :||  |...|..:.|.|        ||||.|:.|.
Zfish   242 AFRSFGRYMEKLHLNDM-------------SLE--KFSNAAFEGVTA--------LKSLHLENNK 283

  Fly   475 LKRIPN---LSSCRDLRL-----------------LDLSSNQIEKIQGKPFNGL-KQLNDLLLSY 518
            |:.:||   .|:.:::.|                 :|.:.|:.:.:...|.|.. ||:.| ..::
Zfish   284 LRSLPNSLEFSTIQNITLFNNPWSCTCPLTNLRKWMDTTRNRPDAVCASPANQKGKQIRD-STAF 347

  Fly   519 NRIKALPQDAFQG 531
            .|.|...:.|.:|
Zfish   348 TRCKGKTKRARKG 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rkNP_476702.1 leucine-rich repeat 158..179 CDD:275380 4/20 (20%)
LRR_RI 180..>383 CDD:238064 55/203 (27%)
leucine-rich repeat 183..204 CDD:275380 7/20 (35%)
LRR_8 203..263 CDD:290566 21/59 (36%)
leucine-rich repeat 205..228 CDD:275380 8/22 (36%)
leucine-rich repeat 229..252 CDD:275380 6/22 (27%)
LRR_8 252..311 CDD:290566 13/58 (22%)
leucine-rich repeat 253..276 CDD:275380 8/22 (36%)
leucine-rich repeat 277..300 CDD:275380 1/22 (5%)
LRR_8 299..359 CDD:290566 17/59 (29%)
leucine-rich repeat 301..324 CDD:275380 6/22 (27%)
leucine-rich repeat 325..348 CDD:275380 6/22 (27%)
LRR_RI 327..567 CDD:238064 57/228 (25%)
leucine-rich repeat 349..371 CDD:275380 10/22 (45%)
LRR_8 370..425 CDD:290566 13/55 (24%)
leucine-rich repeat 372..393 CDD:275380 2/20 (10%)
leucine-rich repeat 394..415 CDD:275380 8/20 (40%)
leucine-rich repeat 418..486 CDD:275380 20/70 (29%)
leucine-rich repeat 441..464 CDD:275378 6/22 (27%)
LRR_8 487..545 CDD:290566 12/63 (19%)
leucine-rich repeat 487..510 CDD:275380 5/40 (13%)
leucine-rich repeat 511..534 CDD:275380 5/21 (24%)
LRR_8 533..589 CDD:290566
leucine-rich repeat 535..558 CDD:275380
leucine-rich repeat 559..580 CDD:275380
7tm_4 764..>892 CDD:304433
7tm_1 770..1017 CDD:278431
chadNP_957357.1 LRRNT 26..52 CDD:279764 8/23 (35%)
leucine-rich repeat 57..80 CDD:275380 7/22 (32%)
LRR_8 79..139 CDD:290566 21/59 (36%)
leucine-rich repeat 81..104 CDD:275380 8/22 (36%)
LRR_RI <96..304 CDD:238064 73/276 (26%)
LRR_4 104..143 CDD:289563 15/62 (24%)
leucine-rich repeat 105..128 CDD:275380 6/22 (27%)
LRR_8 127..187 CDD:290566 18/83 (22%)
leucine-rich repeat 129..152 CDD:275380 9/46 (20%)
leucine-rich repeat 153..176 CDD:275380 6/22 (27%)
LRR_8 177..235 CDD:290566 19/79 (24%)
leucine-rich repeat 177..200 CDD:275380 6/22 (27%)
leucine-rich repeat 201..224 CDD:275380 10/22 (45%)
LRR_8 225..284 CDD:290566 26/103 (25%)
leucine-rich repeat 225..248 CDD:275380 10/44 (23%)
leucine-rich repeat 250..273 CDD:275380 9/37 (24%)
LRRCT 304..351 CDD:214507 8/47 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.