| Sequence 1: | NP_476702.1 | Gene: | rk / 34819 | FlyBaseID: | FBgn0003255 | Length: | 1360 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_956909.1 | Gene: | lrfn1 / 393587 | ZFINID: | ZDB-GENE-040426-1227 | Length: | 584 | Species: | Danio rerio |
| Alignment Length: | 308 | Identity: | 85/308 - (27%) |
|---|---|---|---|
| Similarity: | 128/308 - (41%) | Gaps: | 57/308 - (18%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 152 CHCTGSLEVLRLSCRGIGILAVPVNLPNEVVVLDLGNNNLTKLEANSFFMAPNLEELTLSDNSII 216
Fly 217 NMDPNAFYGLAKLKRLSLQNCGLKSLPPQSFQGLAQLTSLQLNGNALVSLDGDCLGHLQKLRTLR 281
Fly 282 LEGNLFYRIPTNAL-AGLRTLEALNLGSNLLTIINDEDFPRMPNLIVLLLKRNQIMKISAGALKN 345
Fly 346 LTALKVLELDDNLISSL-PEGLSKLSQL--QELSITSNRLRWINDTELPRSMQMLDMRANPLSTI 407
Fly 408 SPGAFRGMSKLRKLILSDVRTLRSFPELEACHALEILKLDRA--GIQE 453 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| rk | NP_476702.1 | leucine-rich repeat | 158..179 | CDD:275380 | 7/20 (35%) |
| LRR_RI | 180..>383 | CDD:238064 | 59/206 (29%) | ||
| leucine-rich repeat | 183..204 | CDD:275380 | 5/20 (25%) | ||
| LRR_8 | 203..263 | CDD:290566 | 16/59 (27%) | ||
| leucine-rich repeat | 205..228 | CDD:275380 | 12/22 (55%) | ||
| leucine-rich repeat | 229..252 | CDD:275380 | 1/22 (5%) | ||
| LRR_8 | 252..311 | CDD:290566 | 18/59 (31%) | ||
| leucine-rich repeat | 253..276 | CDD:275380 | 7/22 (32%) | ||
| leucine-rich repeat | 277..300 | CDD:275380 | 6/23 (26%) | ||
| LRR_8 | 299..359 | CDD:290566 | 21/59 (36%) | ||
| leucine-rich repeat | 301..324 | CDD:275380 | 8/22 (36%) | ||
| leucine-rich repeat | 325..348 | CDD:275380 | 7/22 (32%) | ||
| LRR_RI | 327..567 | CDD:238064 | 34/132 (26%) | ||
| leucine-rich repeat | 349..371 | CDD:275380 | 6/22 (27%) | ||
| LRR_8 | 370..425 | CDD:290566 | 10/56 (18%) | ||
| leucine-rich repeat | 372..393 | CDD:275380 | 3/22 (14%) | ||
| leucine-rich repeat | 394..415 | CDD:275380 | 3/20 (15%) | ||
| leucine-rich repeat | 418..486 | CDD:275380 | 13/38 (34%) | ||
| leucine-rich repeat | 441..464 | CDD:275378 | 6/15 (40%) | ||
| LRR_8 | 487..545 | CDD:290566 | |||
| leucine-rich repeat | 487..510 | CDD:275380 | |||
| leucine-rich repeat | 511..534 | CDD:275380 | |||
| LRR_8 | 533..589 | CDD:290566 | |||
| leucine-rich repeat | 535..558 | CDD:275380 | |||
| leucine-rich repeat | 559..580 | CDD:275380 | |||
| 7tm_4 | 764..>892 | CDD:304433 | |||
| 7tm_1 | 770..1017 | CDD:278431 | |||
| lrfn1 | NP_956909.1 | LRR 1 | 52..73 | 6/20 (30%) | |
| LRR_8 | 55..111 | CDD:290566 | 21/79 (27%) | ||
| leucine-rich repeat | 55..76 | CDD:275380 | 5/20 (25%) | ||
| LRR_RI | <71..>208 | CDD:238064 | 48/160 (30%) | ||
| LRR 2 | 76..97 | 10/20 (50%) | |||
| leucine-rich repeat | 77..100 | CDD:275380 | 12/22 (55%) | ||
| LRR_8 | 99..160 | CDD:290566 | 19/84 (23%) | ||
| LRR 3 | 100..121 | 7/44 (16%) | |||
| leucine-rich repeat | 101..124 | CDD:275380 | 8/46 (17%) | ||
| LRR 4 | 124..145 | 6/20 (30%) | |||
| leucine-rich repeat | 125..148 | CDD:275380 | 6/22 (27%) | ||
| LRR 5 | 149..170 | 7/20 (35%) | |||
| leucine-rich repeat | 150..173 | CDD:275380 | 8/22 (36%) | ||
| LRR_8 | 153..208 | CDD:290566 | 19/54 (35%) | ||
| LRR 6 | 173..194 | 7/20 (35%) | |||
| leucine-rich repeat | 174..197 | CDD:275380 | 7/22 (32%) | ||
| LRR 7 | 197..218 | 6/20 (30%) | |||
| leucine-rich repeat | 198..222 | CDD:275380 | 6/23 (26%) | ||
| LRRCT | 241..>270 | CDD:214507 | 11/41 (27%) | ||
| IG_like | 299..375 | CDD:214653 | |||
| Ig_2 | 303..376 | CDD:143241 | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 393..414 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 539..564 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||