| Sequence 1: | NP_476702.1 | Gene: | rk / 34819 | FlyBaseID: | FBgn0003255 | Length: | 1360 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_849161.2 | Gene: | LRRTM1 / 347730 | HGNCID: | 19408 | Length: | 522 | Species: | Homo sapiens |
| Alignment Length: | 275 | Identity: | 73/275 - (26%) |
|---|---|---|---|
| Similarity: | 128/275 - (46%) | Gaps: | 7/275 - (2%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 152 CHCTGSLEVLRLSCRGIGILAVPVNLPNEVVVLDLGNNNLTKLEANSFFMAPNLEELTLSDNSII 216
Fly 217 NMDPNAFYGLAKLKRLSLQNCGLKSLPPQSFQGLAQLTSLQLNGNALVSLDGDCLGHLQKLRTLR 281
Fly 282 LEGNLFYRIPTNALAGLRTLEALNLGSNLLTIINDEDFPRMPNLIVLLLKRNQIMKISAGALKNL 346
Fly 347 TALKVLELDDNLISSLPEGLSKLSQLQELSITSNRLRWIND--TELPRSMQMLDMRANPLSTISP 409
Fly 410 GAFRGMSKLRKLILS 424 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| rk | NP_476702.1 | leucine-rich repeat | 158..179 | CDD:275380 | 6/20 (30%) |
| LRR_RI | 180..>383 | CDD:238064 | 55/202 (27%) | ||
| leucine-rich repeat | 183..204 | CDD:275380 | 7/20 (35%) | ||
| LRR_8 | 203..263 | CDD:290566 | 18/59 (31%) | ||
| leucine-rich repeat | 205..228 | CDD:275380 | 8/22 (36%) | ||
| leucine-rich repeat | 229..252 | CDD:275380 | 6/22 (27%) | ||
| LRR_8 | 252..311 | CDD:290566 | 19/58 (33%) | ||
| leucine-rich repeat | 253..276 | CDD:275380 | 8/22 (36%) | ||
| leucine-rich repeat | 277..300 | CDD:275380 | 5/22 (23%) | ||
| LRR_8 | 299..359 | CDD:290566 | 17/59 (29%) | ||
| leucine-rich repeat | 301..324 | CDD:275380 | 6/22 (27%) | ||
| leucine-rich repeat | 325..348 | CDD:275380 | 6/22 (27%) | ||
| LRR_RI | 327..567 | CDD:238064 | 21/100 (21%) | ||
| leucine-rich repeat | 349..371 | CDD:275380 | 5/21 (24%) | ||
| LRR_8 | 370..425 | CDD:290566 | 11/57 (19%) | ||
| leucine-rich repeat | 372..393 | CDD:275380 | 3/22 (14%) | ||
| leucine-rich repeat | 394..415 | CDD:275380 | 6/20 (30%) | ||
| leucine-rich repeat | 418..486 | CDD:275380 | 2/7 (29%) | ||
| leucine-rich repeat | 441..464 | CDD:275378 | |||
| LRR_8 | 487..545 | CDD:290566 | |||
| leucine-rich repeat | 487..510 | CDD:275380 | |||
| leucine-rich repeat | 511..534 | CDD:275380 | |||
| LRR_8 | 533..589 | CDD:290566 | |||
| leucine-rich repeat | 535..558 | CDD:275380 | |||
| leucine-rich repeat | 559..580 | CDD:275380 | |||
| 7tm_4 | 764..>892 | CDD:304433 | |||
| 7tm_1 | 770..1017 | CDD:278431 | |||
| LRRTM1 | NP_849161.2 | LRR 1 | 64..87 | 8/23 (35%) | |
| LRR_8 | 73..125 | CDD:290566 | 16/51 (31%) | ||
| LRR_RI | <85..268 | CDD:238064 | 49/182 (27%) | ||
| LRR 2 | 89..111 | 7/21 (33%) | |||
| leucine-rich repeat | 91..114 | CDD:275380 | 8/22 (36%) | ||
| LRR 3 | 112..135 | 7/22 (32%) | |||
| LRR_8 | 113..173 | CDD:290566 | 19/59 (32%) | ||
| leucine-rich repeat | 115..138 | CDD:275380 | 6/22 (27%) | ||
| LRR 4 | 137..159 | 7/21 (33%) | |||
| leucine-rich repeat | 139..162 | CDD:275380 | 8/22 (36%) | ||
| LRR_8 | 161..221 | CDD:290566 | 17/59 (29%) | ||
| LRR 5 | 161..183 | 6/21 (29%) | |||
| leucine-rich repeat | 163..186 | CDD:275380 | 5/22 (23%) | ||
| LRR 6 | 184..207 | 7/22 (32%) | |||
| leucine-rich repeat | 187..210 | CDD:275380 | 6/22 (27%) | ||
| LRR 7 | 209..231 | 5/21 (24%) | |||
| leucine-rich repeat | 211..234 | CDD:275380 | 6/22 (27%) | ||
| LRR 8 | 233..255 | 5/21 (24%) | |||
| leucine-rich repeat | 235..257 | CDD:275380 | 5/21 (24%) | ||
| LRR 9 | 256..278 | 2/21 (10%) | |||
| LRR_8 | 257..315 | CDD:290566 | 11/56 (20%) | ||
| LRR_4 | 257..297 | CDD:289563 | 8/39 (21%) | ||
| leucine-rich repeat | 258..281 | CDD:275380 | 3/22 (14%) | ||
| LRR 10 | 279..302 | 6/22 (27%) | |||
| leucine-rich repeat | 282..300 | CDD:275380 | 6/17 (35%) | ||
| leucine-rich repeat | 306..318 | CDD:275378 | 2/7 (29%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 382..401 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||