Sequence 1: | NP_476702.1 | Gene: | rk / 34819 | FlyBaseID: | FBgn0003255 | Length: | 1360 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001073929.1 | Gene: | LRRIQ4 / 344657 | HGNCID: | 34298 | Length: | 560 | Species: | Homo sapiens |
Alignment Length: | 488 | Identity: | 133/488 - (27%) |
---|---|---|---|
Similarity: | 215/488 - (44%) | Gaps: | 85/488 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 174 PVNLPNEVVVLDLGNNNLTKLEANSFFMAPNLEELTLSDNSIINMDPNAFYGLAKLKRLSLQNCG 238
Fly 239 LKSLPPQSFQGLAQLTSLQLNGNALVSLDGDCLGHLQKLRTLRLEGNLFYRIPTNALAGLRTLEA 303
Fly 304 LNLGSNLLTIINDEDFPRMPNLIVLLLKRNQIMKISAGALKNLTALKVLELDDNLISSLPEGLSK 368
Fly 369 LSQLQELSITSNRLRWINDTELPRS------MQMLDMRANPLSTISPGAFRGMSKLRKLILSDVR 427
Fly 428 TLRSFPELEACH--ALEILKLDRAGIQEV-----------------------PANLCRQTPRLKS 467
Fly 468 LE---LKTNSLKRIPN-LSSCRDLRLLDLSSNQ-------------IEKI-----QG-------K 503
Fly 504 PFNGLKQLNDLLLSYNRIKALPQDAFQGIPKLQLLDLEGNEISYIHKEAFSGFTALEDLNLGNNI 568
Fly 569 FPELPESGLRALLHLKT---FNNPKLREFPPPD 598 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
rk | NP_476702.1 | leucine-rich repeat | 158..179 | CDD:275380 | 1/4 (25%) |
LRR_RI | 180..>383 | CDD:238064 | 61/202 (30%) | ||
leucine-rich repeat | 183..204 | CDD:275380 | 5/20 (25%) | ||
LRR_8 | 203..263 | CDD:290566 | 20/59 (34%) | ||
leucine-rich repeat | 205..228 | CDD:275380 | 8/22 (36%) | ||
leucine-rich repeat | 229..252 | CDD:275380 | 7/22 (32%) | ||
LRR_8 | 252..311 | CDD:290566 | 20/58 (34%) | ||
leucine-rich repeat | 253..276 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 277..300 | CDD:275380 | 8/22 (36%) | ||
LRR_8 | 299..359 | CDD:290566 | 18/59 (31%) | ||
leucine-rich repeat | 301..324 | CDD:275380 | 6/22 (27%) | ||
leucine-rich repeat | 325..348 | CDD:275380 | 8/22 (36%) | ||
LRR_RI | 327..567 | CDD:238064 | 77/299 (26%) | ||
leucine-rich repeat | 349..371 | CDD:275380 | 8/21 (38%) | ||
LRR_8 | 370..425 | CDD:290566 | 17/60 (28%) | ||
leucine-rich repeat | 372..393 | CDD:275380 | 7/20 (35%) | ||
leucine-rich repeat | 394..415 | CDD:275380 | 7/20 (35%) | ||
leucine-rich repeat | 418..486 | CDD:275380 | 22/96 (23%) | ||
leucine-rich repeat | 441..464 | CDD:275378 | 6/45 (13%) | ||
LRR_8 | 487..545 | CDD:290566 | 19/82 (23%) | ||
leucine-rich repeat | 487..510 | CDD:275380 | 9/47 (19%) | ||
leucine-rich repeat | 511..534 | CDD:275380 | 5/22 (23%) | ||
LRR_8 | 533..589 | CDD:290566 | 18/58 (31%) | ||
leucine-rich repeat | 535..558 | CDD:275380 | 5/22 (23%) | ||
leucine-rich repeat | 559..580 | CDD:275380 | 8/20 (40%) | ||
7tm_4 | 764..>892 | CDD:304433 | |||
7tm_1 | 770..1017 | CDD:278431 | |||
LRRIQ4 | NP_001073929.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..20 | 133/488 (27%) | |
LRR 1 | 23..47 | 5/24 (21%) | |||
LRR 2 | 48..70 | 7/22 (32%) | |||
leucine-rich repeat | 50..72 | CDD:275380 | 8/22 (36%) | ||
LRR 3 | 72..95 | 7/23 (30%) | |||
leucine-rich repeat | 73..119 | CDD:275380 | 14/46 (30%) | ||
LRR 4 | 97..116 | 5/18 (28%) | |||
LRR_RI | 117..360 | CDD:238064 | 72/256 (28%) | ||
LRR 5 | 117..140 | 8/22 (36%) | |||
LRR_8 | 120..177 | CDD:290566 | 20/58 (34%) | ||
leucine-rich repeat | 120..143 | CDD:275380 | 8/22 (36%) | ||
LRR 6 | 141..164 | 7/23 (30%) | |||
leucine-rich repeat | 144..166 | CDD:275380 | 6/22 (27%) | ||
LRR 7 | 166..187 | 7/21 (33%) | |||
leucine-rich repeat | 167..189 | CDD:275380 | 8/22 (36%) | ||
LRR 8 | 188..210 | 7/21 (33%) | |||
LRR_8 | 189..246 | CDD:290566 | 19/61 (31%) | ||
leucine-rich repeat | 190..212 | CDD:275380 | 8/21 (38%) | ||
LRR 9 | 212..233 | 8/25 (32%) | |||
leucine-rich repeat | 213..235 | CDD:275380 | 8/26 (31%) | ||
LRR_8 | 234..315 | CDD:290566 | 19/83 (23%) | ||
LRR 10 | 234..256 | 7/22 (32%) | |||
leucine-rich repeat | 236..258 | CDD:275380 | 7/22 (32%) | ||
LRR_RI | 253..501 | CDD:238064 | 61/244 (25%) | ||
LRR 11 | 258..281 | 8/24 (33%) | |||
leucine-rich repeat | 259..304 | CDD:275380 | 11/46 (24%) | ||
LRR 12 | 283..301 | 3/17 (18%) | |||
LRR 13 | 302..325 | 2/26 (8%) | |||
leucine-rich repeat | 305..327 | CDD:275380 | 3/25 (12%) | ||
LRR 14 | 326..348 | 7/21 (33%) | |||
leucine-rich repeat | 328..350 | CDD:275380 | 7/21 (33%) | ||
LRR 15 | 350..371 | 4/20 (20%) | |||
leucine-rich repeat | 351..370 | CDD:275380 | 4/18 (22%) | ||
leucine-rich repeat | 374..399 | CDD:275380 | 5/24 (21%) | ||
LRR 16 | 374..397 | 4/22 (18%) | |||
LRR 17 | 398..422 | 5/24 (21%) | |||
LRR_8 | 399..456 | CDD:290566 | 16/58 (28%) | ||
leucine-rich repeat | 400..422 | CDD:275380 | 5/22 (23%) | ||
leucine-rich repeat | 423..445 | CDD:275380 | 5/22 (23%) | ||
LRR 18 | 424..443 | 4/19 (21%) | |||
LRR 19 | 444..466 | 9/22 (41%) | |||
leucine-rich repeat | 446..468 | CDD:275380 | 9/22 (41%) | ||
LRR 20 | 468..489 | 7/20 (35%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 529..560 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |