DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rk and CG3040

DIOPT Version :9

Sequence 1:NP_476702.1 Gene:rk / 34819 FlyBaseID:FBgn0003255 Length:1360 Species:Drosophila melanogaster
Sequence 2:NP_572372.1 Gene:CG3040 / 31642 FlyBaseID:FBgn0029925 Length:238 Species:Drosophila melanogaster


Alignment Length:282 Identity:70/282 - (24%)
Similarity:110/282 - (39%) Gaps:89/282 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   252 QLTSLQLNGNALVSLDGDCLGHLQK-----------LRTLRLEGNLFYRIPTNALAGLRTLEALN 305
            ||.:.|..|...:||.     .||:           |:||.|..|.|.|:| :.|..|..|:.||
  Fly     9 QLETAQKTGILKISLQ-----RLQEFPLQLRAYPNVLKTLDLSENRFERVP-DELGKLTLLKHLN 67

  Fly   306 LGSNLLTIINDEDFPRMPNLIVLLLKRNQIMKISAGALKNLTALKVLELDDNLISSLPEGLSKLS 370
            |..|.|..:| |....:..|.||||..|.:.::.. .|.|.|.||.:.|.:|.:...|..|..|.
  Fly    68 LSGNRLVELN-EVVGELAKLEVLLLMDNMLTRLPK-TLANCTHLKTVNLSNNQLKEFPSMLCGLK 130

  Fly   371 QLQELSITSNRLRWINDTELPRS-----MQMLDMRANPLSTISPGAFRGMSKLRKLILSDVRTLR 430
            ||..|.::.|::     |::|..     :..|::..|.:|:::                      
  Fly   131 QLDVLDLSRNKI-----TDVPADVGGLFVTELNLNQNQISSLA---------------------- 168

  Fly   431 SFPELEACHALEILKLDRAGIQEVPANLCRQTPRLKSLELKTNSLKR---IPNLSSCRDLRLLDL 492
              .|:..|                        |:||:|.|:.|.|:.   .|.:  .:|.::.:|
  Fly   169 --EEVADC------------------------PKLKTLRLEENCLQAAAFTPKI--LKDSKICNL 205

  Fly   493 SSNQIEKIQGKPFNGLKQLNDL 514
            :      :.|..||. ||..||
  Fly   206 A------VDGNLFNS-KQFTDL 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rkNP_476702.1 leucine-rich repeat 158..179 CDD:275380
LRR_RI 180..>383 CDD:238064 46/141 (33%)
leucine-rich repeat 183..204 CDD:275380
LRR_8 203..263 CDD:290566 4/10 (40%)
leucine-rich repeat 205..228 CDD:275380
leucine-rich repeat 229..252 CDD:275380 70/282 (25%)
LRR_8 252..311 CDD:290566 23/69 (33%)
leucine-rich repeat 253..276 CDD:275380 6/22 (27%)
leucine-rich repeat 277..300 CDD:275380 10/22 (45%)
LRR_8 299..359 CDD:290566 21/59 (36%)
leucine-rich repeat 301..324 CDD:275380 8/22 (36%)
leucine-rich repeat 325..348 CDD:275380 8/22 (36%)
LRR_RI 327..567 CDD:238064 43/196 (22%)
leucine-rich repeat 349..371 CDD:275380 7/21 (33%)
LRR_8 370..425 CDD:290566 9/59 (15%)
leucine-rich repeat 372..393 CDD:275380 5/20 (25%)
leucine-rich repeat 394..415 CDD:275380 3/20 (15%)
leucine-rich repeat 418..486 CDD:275380 10/70 (14%)
leucine-rich repeat 441..464 CDD:275378 0/22 (0%)
LRR_8 487..545 CDD:290566 8/28 (29%)
leucine-rich repeat 487..510 CDD:275380 4/22 (18%)
leucine-rich repeat 511..534 CDD:275380 2/4 (50%)
LRR_8 533..589 CDD:290566
leucine-rich repeat 535..558 CDD:275380
leucine-rich repeat 559..580 CDD:275380
7tm_4 764..>892 CDD:304433
7tm_1 770..1017 CDD:278431
CG3040NP_572372.1 LRR_RI 4..192 CDD:238064 60/243 (25%)
leucine-rich repeat 18..39 CDD:275380 4/25 (16%)
LRR_8 40..96 CDD:290566 24/57 (42%)
leucine-rich repeat 40..62 CDD:275380 10/22 (45%)
leucine-rich repeat 63..85 CDD:275380 8/22 (36%)
LRR_8 85..142 CDD:290566 20/57 (35%)
leucine-rich repeat 86..108 CDD:275380 8/22 (36%)
leucine-rich repeat 109..131 CDD:275380 7/21 (33%)
LRR_8 130..185 CDD:290566 16/107 (15%)
leucine-rich repeat 132..151 CDD:275380 5/23 (22%)
leucine-rich repeat 154..176 CDD:275380 5/69 (7%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.