DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rk and OPTC

DIOPT Version :9

Sequence 1:NP_476702.1 Gene:rk / 34819 FlyBaseID:FBgn0003255 Length:1360 Species:Drosophila melanogaster
Sequence 2:NP_055174.1 Gene:OPTC / 26254 HGNCID:8158 Length:332 Species:Homo sapiens


Alignment Length:416 Identity:109/416 - (26%)
Similarity:153/416 - (36%) Gaps:130/416 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 LEVLRLSCRGIGILAVP--------VNLPNE---VVVLDLGNNNLTKLEANSFFMAPNLEELT-- 209
            |.:|.|..:..|..::|        ..:|.|   ..||.|.|:.|............|.||||  
Human     7 LSLLALVLQETGTASLPRKERKRREEQMPREGDSFEVLPLRNDVLNPDNYGEVIDLSNYEELTDY 71

  Fly   210 ---LSDNSIINMDPNAFYGLAKLKRLSLQNCGLKSLPP----QSFQGLAQLTSLQLNGNALVSLD 267
               |.:..:.::.|......||    |....|..|..|    .:..||  |.|.|.|        
Human    72 GDQLPEVKVTSLAPATSISPAK----STTAPGTPSSNPTMTRPTTAGL--LLSSQPN-------- 122

  Fly   268 GDCLGHLQKLRTLRLEGNLFYRIPTNALAGLRTLEALNLGSNL-LTIINDEDFPRMPNLIVLLLK 331
                                :.:||       .|..:.|||:: ...|:.||.|.:|.....|..
Human   123 --------------------HGLPT-------CLVCVCLGSSVYCDDIDLEDIPPLPRRTAYLYA 160

  Fly   332 R-NQIMKISAGALKNLTALKVLELDDNLISSLP-EGLSKLSQLQELSITSNRLRWINDTELPRSM 394
            | |:|.:|.|...|.||.||.::|.:|||||:. :....|..||:|.:..|:|..:  ..||..:
Human   161 RFNRISRIRAEDFKGLTKLKRIDLSNNLISSIDNDAFRLLHALQDLILPENQLEAL--PVLPSGI 223

  Fly   395 QMLDMRANPL--STISPGAFRGMSKLRKLILSDVRTLRSFPELEACHALEILKLDRAGIQEVPAN 457
            :.||:|.|.|  |.|.|.|||.|.||:.|.|||                                
Human   224 EFLDVRLNRLQSSGIQPAAFRAMEKLQFLYLSD-------------------------------- 256

  Fly   458 LCRQTPRLKSLELKTNSLKRIPN---LSSCRDLRLLDLSSNQIEKIQGKPF-------NGLKQLN 512
                           |.|..||.   ||    ||.:.|.:|.||.:|...|       :..:||.
Human   257 ---------------NLLDSIPGPLPLS----LRSVHLQNNLIETMQRDVFCDPEEHKHTRRQLE 302

  Fly   513 DLLLSYNRIK-ALPQDAFQGIPKLQL 537
            |:.|..|.|. :|...|:..:|:|.:
Human   303 DIRLDGNPINLSLFPSAYFCLPRLPI 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rkNP_476702.1 leucine-rich repeat 158..179 CDD:275380 5/28 (18%)
LRR_RI 180..>383 CDD:238064 58/217 (27%)
leucine-rich repeat 183..204 CDD:275380 5/20 (25%)
LRR_8 203..263 CDD:290566 19/68 (28%)
leucine-rich repeat 205..228 CDD:275380 6/27 (22%)
leucine-rich repeat 229..252 CDD:275380 6/26 (23%)
LRR_8 252..311 CDD:290566 10/59 (17%)
leucine-rich repeat 253..276 CDD:275380 4/22 (18%)
leucine-rich repeat 277..300 CDD:275380 2/22 (9%)
LRR_8 299..359 CDD:290566 22/61 (36%)
leucine-rich repeat 301..324 CDD:275380 8/23 (35%)
leucine-rich repeat 325..348 CDD:275380 8/23 (35%)
LRR_RI 327..567 CDD:238064 67/226 (30%)
leucine-rich repeat 349..371 CDD:275380 9/22 (41%)
LRR_8 370..425 CDD:290566 23/56 (41%)
leucine-rich repeat 372..393 CDD:275380 7/20 (35%)
leucine-rich repeat 394..415 CDD:275380 11/22 (50%)
leucine-rich repeat 418..486 CDD:275380 11/70 (16%)
leucine-rich repeat 441..464 CDD:275378 0/22 (0%)
LRR_8 487..545 CDD:290566 18/59 (31%)
leucine-rich repeat 487..510 CDD:275380 8/29 (28%)
leucine-rich repeat 511..534 CDD:275380 7/23 (30%)
LRR_8 533..589 CDD:290566 2/5 (40%)
leucine-rich repeat 535..558 CDD:275380 1/3 (33%)
leucine-rich repeat 559..580 CDD:275380
7tm_4 764..>892 CDD:304433
7tm_1 770..1017 CDD:278431
OPTCNP_055174.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 21..41 3/19 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 86..106 5/23 (22%)
NEL <115..>327 CDD:330839 82/301 (27%)
LRR_8 153..213 CDD:316378 22/59 (37%)
LRR 1 154..175 6/20 (30%)
leucine-rich repeat 155..178 CDD:275380 8/22 (36%)
LRR 2 178..199 8/20 (40%)
leucine-rich repeat 179..202 CDD:275380 9/22 (41%)
LRR 3 202..223 7/22 (32%)
leucine-rich repeat 203..221 CDD:275380 6/19 (32%)
leucine-rich repeat 223..248 CDD:275380 12/24 (50%)
LRR 4 248..269 10/67 (15%)
leucine-rich repeat 249..269 CDD:275380 9/66 (14%)
leucine-rich repeat 270..300 CDD:275380 8/29 (28%)
LRR 5 270..290 8/19 (42%)
LRR 6 300..320 7/19 (37%)
leucine-rich repeat 301..325 CDD:275380 7/23 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.