DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rk and FSHR

DIOPT Version :9

Sequence 1:NP_476702.1 Gene:rk / 34819 FlyBaseID:FBgn0003255 Length:1360 Species:Drosophila melanogaster
Sequence 2:XP_011531035.1 Gene:FSHR / 2492 HGNCID:3969 Length:729 Species:Homo sapiens


Alignment Length:783 Identity:237/783 - (30%)
Similarity:372/783 - (47%) Gaps:142/783 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   294 ALAGLRTLEALNLG----------SNLLTIIND-------EDFPRMPNLIVLLLKRNQIMKISAG 341
            ||..:..|..|:||          ||.:.:..:       .|.||  |.|.|.....::..|..|
Human     2 ALLLVSLLAFLSLGSGCHHRICHCSNRVFLCQESKVTEIPSDLPR--NAIELRFVLTKLRVIQKG 64

  Fly   342 ALKNLTALKVLELDDNLISSLPEG--LSKLSQLQELSITSNRLRWINDTELPRSMQMLDMRANPL 404
            |......|:.:|:..|.:..:.|.  .|.|.:|.|:.|.                     :||.|
Human    65 AFSGFGDLEKIEISQNDVLEVIEADVFSNLPKLHEIRIE---------------------KANNL 108

  Fly   405 STISPGAFRGMSKLRKLILSDVRTLRSFPELEACHALEILKLDRAGIQEVPANLCRQTPRLKSLE 469
            ..|:|.||:.:..|:.|::|:. .::..|::...|:|:.:.||   ||:               .
Human   109 LYINPEAFQNLPNLQYLLISNT-GIKHLPDVHKIHSLQKVLLD---IQD---------------N 154

  Fly   470 LKTNSLKRIPNLSSCRDLRLLDLSSNQIEKIQGKPFNGLKQLNDLLLS-YNRIKALPQDAFQGIP 533
            :..::::|...:....:..:|.|:.|.|::|....||| .||::|.|| .|.::.||.|.|.|..
Human   155 INIHTIERNSFVGLSFESVILWLNKNGIQEIHNCAFNG-TQLDELNLSDNNNLEELPNDVFHGAS 218

  Fly   534 KLQLLDLE---GNEISYIHKEAFSGFTALED-------LNLGNNIFPELPESGLRALLHLKTFNN 588
            ...:|:..   ..|.:.:..:..||...||:       :::.......||..||..|..|:..:.
Human   219 GPVILNRRTRTPTEPNVLLAKYPSGQGVLEEPESLSSSIDISRTRIHSLPSYGLENLKKLRARST 283

  Fly   589 PKLREFPPPDTFPRIQTLILSYAYHCCAFLPLVAMSSQKKTSQVQEAVLFPSDAEFDMTLWNNSM 653
            ..|::.|..:....:....|:|..|||||.                                   
Human   284 YNLKKLPTLEKLVALMEASLTYPSHCCAFA----------------------------------- 313

  Fly   654 MNIWPQMHNLSKQLGASMHDPWETAINFNEEQLQTQTGGQIATSYMEEYFEEHDVSGPATGYGFG 718
                    |..:|: :.:|.....:|...|....||..||.::      ..|.:.|..:.|:   
Human   314 --------NWRRQI-SELHPICNKSILRQEVDYMTQARGQRSS------LAEDNESSYSRGF--- 360

  Fly   719 TGLFSGMSTEDF------QPGSVQCLPMPGPFLPCADLFDWWTLRCGVWVVFLLSLLGNGTVVFV 777
                 .|:..:|      :...|.|.|.|..|.||.|:..:..||..:|.:.:|::.||..|:.:
Human   361 -----DMTYTEFDYDLCNEVVDVTCSPKPDAFNPCEDIMGYNILRVLIWFISILAITGNIIVLVI 420

  Fly   778 LLCSRSKMDVPRFLVCNLAAADFFMGIYLGILAIVDAATLGEFRMFAIPWQMSVLCQLSGFLAVL 842
            |..|:.|:.|||||:||||.||..:||||.::|.||..|..::..:||.||....|..:||..|.
Human   421 LTTSQYKLTVPRFLMCNLAFADLCIGIYLLLIASVDIHTKSQYHNYAIDWQTGAGCDAAGFFTVF 485

  Fly   843 SSELSVYTLAVITLERNYAITHAIHLNKRLSLKQAGYIMSVGWVFALIMALMPLVGVSDYRKFAV 907
            :||||||||..|||||.:.||||:.|:.::.|:.|..:|.:||:||...||.|:.|:|.|.|.::
Human   486 ASELSVYTLTAITLERWHTITHAMQLDCKVQLRHAASVMVMGWIFAFAAALFPIFGISSYMKVSI 550

  Fly   908 CLPFETTTGPASLTYVISLMFINGCAFLTLMGCYLKMYWAIRGSQ-AWNTNDSRIAKRMALLVFT 971
            |||.:..: |.|..||:||:.:|..||:.:.|||:.:|..:|... ..:::|:|||||||:|:||
Human   551 CLPMDIDS-PLSQLYVMSLLVLNVLAFVVICGCYIHIYLTVRNPNIVSSSSDTRIAKRMAMLIFT 614

  Fly   972 DFLCWSPIAFFSITAIFGLQLISLEQAKIFTVFVLPLNSCCNPFLYAIMTKQFKKDCVTL---CK 1033
            ||||.:||:||:|:|...:.||::.:|||..|...|:|||.|||||||.||.|::|...|   |.
Human   615 DFLCMAPISFFAISASLKVPLITVSKAKILLVLFHPINSCANPFLYAIFTKNFRRDFFILLSKCG 679

  Fly  1034 HFE 1036
            .:|
Human   680 CYE 682

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rkNP_476702.1 leucine-rich repeat 158..179 CDD:275380
LRR_RI 180..>383 CDD:238064 26/107 (24%)
leucine-rich repeat 183..204 CDD:275380
LRR_8 203..263 CDD:290566
leucine-rich repeat 205..228 CDD:275380
leucine-rich repeat 229..252 CDD:275380
LRR_8 252..311 CDD:290566 8/26 (31%)
leucine-rich repeat 253..276 CDD:275380
leucine-rich repeat 277..300 CDD:275380 2/5 (40%)
LRR_8 299..359 CDD:290566 18/76 (24%)
leucine-rich repeat 301..324 CDD:275380 9/39 (23%)
leucine-rich repeat 325..348 CDD:275380 5/22 (23%)
LRR_RI 327..567 CDD:238064 56/252 (22%)
leucine-rich repeat 349..371 CDD:275380 6/23 (26%)
LRR_8 370..425 CDD:290566 12/54 (22%)
leucine-rich repeat 372..393 CDD:275380 3/20 (15%)
leucine-rich repeat 394..415 CDD:275380 7/20 (35%)
leucine-rich repeat 418..486 CDD:275380 11/67 (16%)
leucine-rich repeat 441..464 CDD:275378 5/22 (23%)
LRR_8 487..545 CDD:290566 20/61 (33%)
leucine-rich repeat 487..510 CDD:275380 8/22 (36%)
leucine-rich repeat 511..534 CDD:275380 10/23 (43%)
LRR_8 533..589 CDD:290566 12/65 (18%)
leucine-rich repeat 535..558 CDD:275380 4/25 (16%)
leucine-rich repeat 559..580 CDD:275380 6/27 (22%)
7tm_4 764..>892 CDD:304433 59/127 (46%)
7tm_1 770..1017 CDD:278431 116/247 (47%)
FSHRXP_011531035.1 LRRNT 20..50 CDD:214470 6/31 (19%)
LRR_5 61..216 CDD:290045 48/195 (25%)
leucine-rich repeat 72..96 CDD:275380 6/23 (26%)
leucine-rich repeat 97..121 CDD:275380 10/44 (23%)
leucine-rich repeat 122..143 CDD:275380 4/21 (19%)
leucine-rich repeat 144..172 CDD:275380 6/45 (13%)
leucine-rich repeat 173..194 CDD:275380 8/21 (38%)
leucine-rich repeat 195..216 CDD:275380 9/20 (45%)
leucine-rich repeat 220..246 CDD:275380 4/25 (16%)
leucine-rich repeat 247..277 CDD:275380 7/29 (24%)
GnHR_trans 316..383 CDD:289164 15/81 (19%)
7tm_1 413..660 CDD:278431 116/247 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2087
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.