DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rk and Lrrc55

DIOPT Version :9

Sequence 1:NP_476702.1 Gene:rk / 34819 FlyBaseID:FBgn0003255 Length:1360 Species:Drosophila melanogaster
Sequence 2:XP_006499531.1 Gene:Lrrc55 / 241528 MGIID:2685197 Length:311 Species:Mus musculus


Alignment Length:172 Identity:54/172 - (31%)
Similarity:81/172 - (47%) Gaps:12/172 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   424 SDVRTLRSFPELEACHALEILKLDRAGIQEVPANLCRQTPRLKSLELKTNSLKRIP--NLSSCRD 486
            ||..|  |.|.|..|.. :::......:..||.:|...|   ::|.|..|.:..:|  .|:...:
Mouse    45 SDAGT--SCPVLCTCRN-QVVDCSNQRLFSVPPDLPMDT---RNLSLAHNRIAAVPPGYLTCYME 103

  Fly   487 LRLLDLSSNQIEKIQGKPFNGLKQLNDLLLSYNRIKALPQDAFQGIPKLQLLDLEGNE-ISYIHK 550
            ||:|||.:|.:.::....|...|:|..|.||||.:..:|.|.|:....|..:||..|. :..:|.
Mouse   104 LRVLDLRNNSLMELPPGLFLHAKRLAHLDLSYNNLSHVPADMFREAHGLVHIDLSHNPWLRRVHP 168

  Fly   551 EAFSGFTALEDLNL--GNNIFPELPE-SGLRALLHLKTFNNP 589
            :||.|...|.||:|  |...|..|.. .||..|:.|:...||
Mouse   169 QAFQGLVHLRDLDLSYGGLAFLSLEALEGLPGLVTLQIGGNP 210

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
rkNP_476702.1 leucine-rich repeat 158..179 CDD:275380
LRR_RI 180..>383 CDD:238064
leucine-rich repeat 183..204 CDD:275380
LRR_8 203..263 CDD:290566
leucine-rich repeat 205..228 CDD:275380
leucine-rich repeat 229..252 CDD:275380
LRR_8 252..311 CDD:290566
leucine-rich repeat 253..276 CDD:275380
leucine-rich repeat 277..300 CDD:275380
LRR_8 299..359 CDD:290566
leucine-rich repeat 301..324 CDD:275380
leucine-rich repeat 325..348 CDD:275380
LRR_RI 327..567 CDD:238064 46/147 (31%)
leucine-rich repeat 349..371 CDD:275380