DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rk and FLRT2

DIOPT Version :9

Sequence 1:NP_476702.1 Gene:rk / 34819 FlyBaseID:FBgn0003255 Length:1360 Species:Drosophila melanogaster
Sequence 2:NP_001333072.1 Gene:FLRT2 / 23768 HGNCID:3761 Length:660 Species:Homo sapiens


Alignment Length:689 Identity:147/689 - (21%)
Similarity:231/689 - (33%) Gaps:233/689 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 CHCTGSLEVLRLSCRGIGILAVPVNLPNEVVVLDLGNNNLTKLEANSFFMAPNLEELTLSDNSII 216
            |.|..:.    :.|....:.:||:.:|..|.||.|.||                           
Human    40 CRCDRNF----VYCNERSLTSVPLGIPEGVTVLYLHNN--------------------------- 73

  Fly   217 NMDPNAFYGLAKLKRLSLQNCGLKSLPPQSFQGLAQLTSLQLNGNALVSLDGDCLGHLQKLRTLR 281
                            .:.|.|.    |.....:..:.::.|.||   .||...:...:.:|.|.
Human    74 ----------------QINNAGF----PAELHNVQSVHTVYLYGN---QLDEFPMNLPKNVRVLH 115

  Fly   282 LEGNLFYRIPTNALAGLRTLEALNLGSNLLTIINDEDFPRMPNLIVLLLKRNQIMKISAGALKNL 346
            |:.|....|...|||.|..||.|:|..|.::.:..||                      ||.:..
Human   116 LQENNIQTISRAALAQLLKLEELHLDDNSISTVGVED----------------------GAFREA 158

  Fly   347 TALKVLELDDNLISSLPEGLSKLSQLQELSITSNRLRWINDTELPRSMQMLDMRANPLSTISPGA 411
            .:||:|.|..|.:||:|.||.  ..||||.:..||:..|:|.                      |
Human   159 ISLKLLFLSKNHLSSVPVGLP--VDLQELRVDENRIAVISDM----------------------A 199

  Fly   412 FRGMSKLRKLIL-SDVRTLRSFPELEACHALEILKLDRAGIQEVPANLCRQTPRLKSLELKTNSL 475
            |:.::.|.:||: .::.|.:...|....|                      ..:||...:..|||
Human   200 FQNLTSLERLIVDGNLLTNKGIAEGTFSH----------------------LTKLKEFSIVRNSL 242

  Fly   476 KR-IPNLSSCRDLRLLDLSSNQIEKIQGKPFNGLKQLNDLLLSYNRIKALPQDAFQGIPKLQLLD 539
            .. .|:|.....:||. |..|||..|....|:.|::|..|.:|.|:::.|.|..|..:..|:.|.
Human   243 SHPPPDLPGTHLIRLY-LQDNQINHIPLTAFSNLRKLERLDISNNQLRMLTQGVFDNLSNLKQLT 306

  Fly   540 LEGNE-------------ISYIHKEA-FSGF----------TALEDLNLGNNIFPELPESGLRAL 580
            ...|.             :.||.... ..||          .|:.:||:.              |
Human   307 ARNNPWFCDCSIKWVTEWLKYIPSSLNVRGFMCQGPEQVRGMAVRELNMN--------------L 357

  Fly   581 LHLKTFNNPKLREF-PPPDT-FPRIQTLILSYAYHCCAFLPLVAMSSQKKT-------------- 629
            |...| ..|.|..| |.|.| .|..|...||......::.|....:|:..|              
Human   358 LSCPT-TTPGLPLFTPAPSTASPTTQPPTLSIPNPSRSYTPPTPTTSKLPTIPDWDGRERVTPPI 421

  Fly   630 -SQVQEAVLFPSDAEFDMTLWNNSMMNI------WPQM-HNLSKQLGASMHDPWETAINFNEEQ- 685
             .::|.::.|.:|....:: | .|:..:      |.:| |:|   :|..:.:    .|...|:| 
Human   422 SERIQLSIHFVNDTSIQVS-W-LSLFTVMAYKLTWVKMGHSL---VGGIVQE----RIVSGEKQH 477

  Fly   686 -----LQTQTGGQIATSYMEEY---FEEHDVSGPATGYG--FGTGLFSGMSTEDFQPGSVQCLPM 740
                 |:.::..:|....::.:   ..|..:...||.:.  ...|..:..|.|.....|     |
Human   478 LSLVNLEPRSTYRICLVPLDAFNYRAVEDTICSEATTHASYLNNGSNTASSHEQTTSHS-----M 537

  Fly   741 PGPFLPCADLFDWWTLRCGVWVVFLLSLLGNGTVVFVLL 779
            ..|||                   |..|:| |.|:|||:
Human   538 GSPFL-------------------LAGLIG-GAVIFVLV 556

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rkNP_476702.1 leucine-rich repeat 158..179 CDD:275380 3/20 (15%)
LRR_RI 180..>383 CDD:238064 48/202 (24%)
leucine-rich repeat 183..204 CDD:275380 5/20 (25%)
LRR_8 203..263 CDD:290566 6/59 (10%)
leucine-rich repeat 205..228 CDD:275380 0/22 (0%)
leucine-rich repeat 229..252 CDD:275380 3/22 (14%)
LRR_8 252..311 CDD:290566 19/58 (33%)
leucine-rich repeat 253..276 CDD:275380 5/22 (23%)
leucine-rich repeat 277..300 CDD:275380 9/22 (41%)
LRR_8 299..359 CDD:290566 14/59 (24%)
leucine-rich repeat 301..324 CDD:275380 7/22 (32%)
leucine-rich repeat 325..348 CDD:275380 2/22 (9%)
LRR_RI 327..567 CDD:238064 61/265 (23%)
leucine-rich repeat 349..371 CDD:275380 10/21 (48%)
LRR_8 370..425 CDD:290566 13/55 (24%)
leucine-rich repeat 372..393 CDD:275380 8/20 (40%)
leucine-rich repeat 394..415 CDD:275380 2/20 (10%)
leucine-rich repeat 418..486 CDD:275380 13/69 (19%)
leucine-rich repeat 441..464 CDD:275378 0/22 (0%)
LRR_8 487..545 CDD:290566 19/70 (27%)
leucine-rich repeat 487..510 CDD:275380 9/22 (41%)
leucine-rich repeat 511..534 CDD:275380 7/22 (32%)
LRR_8 533..589 CDD:290566 13/79 (16%)
leucine-rich repeat 535..558 CDD:275380 7/46 (15%)
leucine-rich repeat 559..580 CDD:275380 2/20 (10%)
7tm_4 764..>892 CDD:304433 8/16 (50%)
7tm_1 770..1017 CDD:278431 6/10 (60%)
FLRT2NP_001333072.1 LRRNT 35..66 CDD:214470 6/29 (21%)
NEL <54..>265 CDD:330839 73/329 (22%)
LRR 1 64..85 9/67 (13%)
leucine-rich repeat 65..86 CDD:275378 9/67 (13%)
LRR 2 89..109 5/22 (23%)
leucine-rich repeat 90..110 CDD:275380 5/22 (23%)
LRR 3 110..131 7/20 (35%)
leucine-rich repeat 111..134 CDD:275380 9/22 (41%)
LRR 4 134..155 8/42 (19%)
leucine-rich repeat 135..160 CDD:275380 9/46 (20%)
LRR 5 160..181 10/22 (45%)
leucine-rich repeat 161..181 CDD:275380 10/21 (48%)
leucine-rich repeat 182..205 CDD:275380 10/44 (23%)
LRR 6 182..202 10/41 (24%)
LRR 7 205..225 5/19 (26%)
leucine-rich repeat 206..231 CDD:275380 6/46 (13%)
LRR 8 231..252 7/20 (35%)
leucine-rich repeat 232..253 CDD:275380 7/20 (35%)
LRR_8 252..311 CDD:316378 18/59 (31%)
LRR 9 253..274 8/21 (38%)
leucine-rich repeat 254..277 CDD:275380 9/23 (39%)
LRR 10 277..298 7/20 (35%)
leucine-rich repeat 278..301 CDD:275380 7/22 (32%)
PCC 282..>359 CDD:188093 16/90 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 373..413 9/39 (23%)
fn3 426..494 CDD:306538 15/76 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.