DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rk and LRRC8B

DIOPT Version :9

Sequence 1:NP_476702.1 Gene:rk / 34819 FlyBaseID:FBgn0003255 Length:1360 Species:Drosophila melanogaster
Sequence 2:NP_001127948.1 Gene:LRRC8B / 23507 HGNCID:30692 Length:803 Species:Homo sapiens


Alignment Length:597 Identity:147/597 - (24%)
Similarity:216/597 - (36%) Gaps:172/597 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 DETKENPAPDMQNSQEQEPYVHLQHLQQQQQQNPQTVQQLSQITVNRTSKSASVTPTGIRENVML 99
            :::..:..||::|.     :..:.||..|...              ..||..|:..:.:.||.: 
Human   352 EKSNYSDIPDVKND-----FAFILHLADQYDP--------------LYSKRFSIFLSEVSENKL- 396

  Fly   100 PSADPEKEAQILYEKSLQEYHGSQLSTASTATDVIAGKRTLHSICERWLQKHCHCTGSLEVLRLS 164
                  |:..:..|.::::.....:..|.       .|..||......|..:......:|||.|.
Human   397 ------KQINLNNEWTVEKLKSKLVKNAQ-------DKIELHLFMLNGLPDNVFELTEMEVLSLE 448

  Fly   165 CRGIGILAVPVNLPNEVVVLDLGNNNLTKLEA--NSF--------FMAPNLEELTLSDNSIINMD 219
                  |...|.||:.|..|    .||.:|..  :|.        |:..||:.|.|....:..: 
Human   449 ------LIPEVKLPSAVSQL----VNLKELRVYHSSLVVDHPALAFLEENLKILRLKFTEMGKI- 502

  Fly   220 PNAFYGLAKLKRLSLQNCGLKSLPPQSFQGLAQLTSLQLNGNALVSLDGDCLGHLQKLRTLRLEG 284
            |...:.|..||.|.|..|.|    |:      ||:::||.|          ...|:.||||.|:.
Human   503 PRWVFHLKNLKELYLSGCVL----PE------QLSTMQLEG----------FQDLKNLRTLYLKS 547

  Fly   285 NLFYRIP---TNALAGLRTLEALNLGSNLLTIINDEDFPRMPNLIVLLLKRNQIMKISAGALKNL 346
            :| .|||   |:.|..|:.|...|.||.|:.:.|                           ||.:
Human   548 SL-SRIPQVVTDLLPSLQKLSLDNEGSKLVVLNN---------------------------LKKM 584

  Fly   347 TALKVLELDDNLISSLPEGLSKLSQLQELSITSNRLRWINDTELPRSMQMLDMRANPLSTISPGA 411
            ..||.|||....:..:|..:..|:.|.|                      ||:|.|.|.|     
Human   585 VNLKSLELISCDLERIPHSIFSLNNLHE----------------------LDLRENNLKT----- 622

  Fly   412 FRGMSKLRKLILSDVRTLRSFPELEACHALEILKLDRAGIQEVPANLCRQTPRLKSLELKTNSLK 476
                          |..:.||..|:   .|..|||....|..:||.: .....|:.|.|..|:::
Human   623 --------------VEEIISFQHLQ---NLSCLKLWHNNIAYIPAQI-GALSNLEQLSLDHNNIE 669

  Fly   477 RIP-NLSSCRDLRLLDLSSNQI----EKIQGKPFNGLKQLNDLLLSYNRIKALPQDAFQGIPKLQ 536
            .:| .|..|..|..||||.|.:    |:||     .|..|....::.|.|:.||...|| ..|||
Human   670 NLPLQLFLCTKLHYLDLSYNHLTFIPEEIQ-----YLSNLQYFAVTNNNIEMLPDGLFQ-CKKLQ 728

  Fly   537 LLDLEGNEISYI--HKEAFSGFTALEDLNLGN---NIFPELPESGLRAL-LHLKTFNNPKLREFP 595
            .|.|..|.:..:  |....|..|.||  .:||   .:.|||  .|.::| .:........|...|
Human   729 CLLLGKNSLMNLSPHVGELSNLTHLE--LIGNYLETLPPEL--EGCQSLKRNCLIVEENLLNTLP 789

  Fly   596 PPDTFPRIQTLI 607
            .|.| .|:||.:
Human   790 LPVT-ERLQTCL 800

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rkNP_476702.1 leucine-rich repeat 158..179 CDD:275380 7/20 (35%)
LRR_RI 180..>383 CDD:238064 55/215 (26%)
leucine-rich repeat 183..204 CDD:275380 6/30 (20%)
LRR_8 203..263 CDD:290566 18/59 (31%)
leucine-rich repeat 205..228 CDD:275380 5/22 (23%)
leucine-rich repeat 229..252 CDD:275380 7/22 (32%)
LRR_8 252..311 CDD:290566 22/61 (36%)
leucine-rich repeat 253..276 CDD:275380 5/22 (23%)
leucine-rich repeat 277..300 CDD:275380 12/25 (48%)
LRR_8 299..359 CDD:290566 13/59 (22%)
leucine-rich repeat 301..324 CDD:275380 6/22 (27%)
leucine-rich repeat 325..348 CDD:275380 2/22 (9%)
LRR_RI 327..567 CDD:238064 65/249 (26%)
leucine-rich repeat 349..371 CDD:275380 7/21 (33%)
LRR_8 370..425 CDD:290566 8/54 (15%)
leucine-rich repeat 372..393 CDD:275380 2/20 (10%)
leucine-rich repeat 394..415 CDD:275380 6/20 (30%)
leucine-rich repeat 418..486 CDD:275380 18/68 (26%)
leucine-rich repeat 441..464 CDD:275378 7/22 (32%)
LRR_8 487..545 CDD:290566 23/61 (38%)
leucine-rich repeat 487..510 CDD:275380 10/26 (38%)
leucine-rich repeat 511..534 CDD:275380 7/22 (32%)
LRR_8 533..589 CDD:290566 18/61 (30%)
leucine-rich repeat 535..558 CDD:275380 7/24 (29%)
leucine-rich repeat 559..580 CDD:275380 8/23 (35%)
7tm_4 764..>892 CDD:304433
7tm_1 770..1017 CDD:278431
LRRC8BNP_001127948.1 Pannexin_like 1..334 CDD:315247
PLN00113 <428..>704 CDD:215061 98/384 (26%)
LRR 1 464..486 5/21 (24%)
leucine-rich repeat 465..488 CDD:275380 4/22 (18%)
LRR 2 488..509 5/21 (24%)
leucine-rich repeat 489..511 CDD:275380 5/22 (23%)
LRR 3 511..532 10/30 (33%)
leucine-rich repeat 512..539 CDD:275380 13/46 (28%)
LRR 4 539..559 10/20 (50%)
leucine-rich repeat 540..562 CDD:275380 11/22 (50%)
LRR 5 562..582 7/46 (15%)
leucine-rich repeat 563..609 CDD:275380 16/72 (22%)
LRR <578..788 CDD:227223 72/291 (25%)
LRR 6 586..607 6/20 (30%)
LRR 7 609..630 10/61 (16%)
leucine-rich repeat 610..634 CDD:275380 12/67 (18%)
LRR 8 634..655 7/21 (33%)
leucine-rich repeat 635..657 CDD:275380 7/22 (32%)
LRR 9 657..678 6/20 (30%)
leucine-rich repeat 658..680 CDD:275380 7/21 (33%)
LRR 10 680..701 9/25 (36%)
leucine-rich repeat 681..703 CDD:275380 10/26 (38%)
LRR 11 703..724 7/21 (33%)
leucine-rich repeat 704..726 CDD:275380 7/22 (32%)
LRR 12 726..747 7/20 (35%)
leucine-rich repeat 727..749 CDD:275380 6/21 (29%)
LRR 13 749..771 9/25 (36%)
leucine-rich repeat 750..772 CDD:275380 9/25 (36%)
leucine-rich repeat 773..796 CDD:275380 5/23 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.