DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rk and PHLPP1

DIOPT Version :9

Sequence 1:NP_476702.1 Gene:rk / 34819 FlyBaseID:FBgn0003255 Length:1360 Species:Drosophila melanogaster
Sequence 2:NP_919431.2 Gene:PHLPP1 / 23239 HGNCID:20610 Length:1717 Species:Homo sapiens


Alignment Length:814 Identity:162/814 - (19%)
Similarity:267/814 - (32%) Gaps:286/814 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 PSAMGHDETKENPAPDMQNSQEQEPYVHLQHLQQQQQQNPQTVQQLSQITVNRTSK---SASVTP 90
            |...||   ...|.|..|.:...:|          ||:.|:.:..........:.:   :|:|.|
Human   394 PRRPGH---PAQPLPLPQTASSPQP----------QQKAPRAIDSPGGAVREGSCEEKAAAAVAP 445

  Fly    91 TGI-----RENVMLPSADPEKEAQILY--------------EKSLQ------------------- 117
            .|:     |..|....|.|......||              ||.||                   
Human   446 GGLQSTPGRSGVTAEKAPPPPPPPTLYVQLHGETTRRLEAEEKPLQIQNDYLFQLGFGELWRVQE 510

  Fly   118 ------------EYHGSQLSTASTATDVIAG-----KRTLHSICERW------------------ 147
                        .|.|...||.|:....::|     |..:.....||                  
Human   511 EGMDSEIGCLIRFYAGKPHSTGSSERIQLSGMYNVRKGKMQLPVNRWTRRQVILCGTCLIVSSVK 575

  Fly   148 -------------------LQKHCHCTG-----------------SLEVLRLSCRGIGILAVPVN 176
                               ::||.||..                 ..|.||. .|.:..:|    
Human   576 DSLTGKMHVLPLIGGKVEEVKKHQHCLAFSSSGPQSQTYYICFDTFTEYLRW-LRQVSKVA---- 635

  Fly   177 LPNEVVVLDLGNNNLTKLEANSFFMAPNLEELTLSDNSIINMDP--------NAFYGLAKLKRLS 233
             ...:..:||...:|..|.||.|: :.:|..|.|..| .:..:|        |......|||.|:
Human   636 -SQRISSVDLSCCSLEHLPANLFY-SQDLTHLNLKQN-FLRQNPSLPAARGLNELQRFTKLKSLN 697

  Fly   234 LQNCGLKSLPPQSFQGLAQLTSLQLNGNALVSLDGDCLGHLQKLRTLRLEGNLFYRIPTNALAGL 298
            |.|..|... |.:...:..|..|.::.|||.|:.. .:|.:..|:|..|:||....:|.. |..:
Human   698 LSNNHLGDF-PLAVCSIPTLAELNVSCNALRSVPA-AVGVMHNLQTFLLDGNFLQSLPAE-LENM 759

  Fly   299 RTLEALNLGSNLLTIIND-----------------------EDFPRMPNLIVLLLKRNQIMKISA 340
            :.|..|.|..|..|.|.:                       :...:||::..:.|:.|.|.|:.|
Human   760 KQLSYLGLSFNEFTDIPEVLEKLTAVDKLCMSGNCVETLRLQALRKMPHIKHVDLRLNVIRKLIA 824

  Fly   341 GALKNLTALKVLELDDN-------------------------------LISSLPEGLSKLSQ--- 371
            ..:..|..:..|:|.||                               .:.:|....::|.|   
Human   825 DEVDFLQHVTQLDLRDNKLGDLDAMIFNNIEVLHCERNQLVTLDICGYFLKALYASSNELVQLDV 889

  Fly   372 ------LQELSITSNRL----RWINDTELPRSMQMLDMRANPLSTISPGAFRGMSKLRKLILSDV 426
                  |..:.::.|||    .|:.::   |.:::||:..|.:..: |......|.|||| |:..
Human   890 YPVPNYLSYMDVSRNRLENVPEWVCES---RKLEVLDIGHNQICEL-PARLFCNSSLRKL-LAGH 949

  Fly   427 RTLRSFPELEACHALEILKLDRAGIQEVPANLCRQTPRLKSLELKTNSL---------------- 475
            ..|...||.....::|:|.:....:.|:|.||..:...|:.|....|.|                
Human   950 NQLARLPERLERTSVEVLDVQHNQLLELPPNLLMKADSLRFLNASANKLESLPPATLSEETNSIL 1014

  Fly   476 ------------KRIPNLSSCRDLRLLDLSSNQIEKIQGKPFNGLKQLNDLLLSYNRIKALPQ-- 526
                        |.:|.|:....|::|.::.|:::.........|::|.::.||.|::||:|.  
Human  1015 QELYLTNNSLTDKCVPLLTGHPHLKILHMAYNRLQSFPASKMAKLEELEEIDLSGNKLKAIPTTI 1079

  Fly   527 ----------------DAF---QGIPKLQLLDLEGNEISYIHKEAFSGFTALEDLNLGNNIFPEL 572
                            :.|   ..:|:::.:||..||:|              ::.|..|:.|:|
Human  1080 MNCRRMHTVIAHSNCIEVFPEVMQLPEIKCVDLSCNELS--------------EVTLPENLPPKL 1130

  Fly   573 PESGL----RALLHLKT---FNNPKLREFPPPDT 599
            .|..|    |.:|..||   .||.:..:...|.|
Human  1131 QELDLTGNPRLVLDHKTLELLNNIRCFKIDQPST 1164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rkNP_476702.1 leucine-rich repeat 158..179 CDD:275380 5/20 (25%)
LRR_RI 180..>383 CDD:238064 60/277 (22%)
leucine-rich repeat 183..204 CDD:275380 7/20 (35%)
LRR_8 203..263 CDD:290566 17/67 (25%)
leucine-rich repeat 205..228 CDD:275380 6/30 (20%)
leucine-rich repeat 229..252 CDD:275380 7/22 (32%)
LRR_8 252..311 CDD:290566 18/58 (31%)
leucine-rich repeat 253..276 CDD:275380 7/22 (32%)
leucine-rich repeat 277..300 CDD:275380 7/22 (32%)
LRR_8 299..359 CDD:290566 18/113 (16%)
leucine-rich repeat 301..324 CDD:275380 7/45 (16%)
leucine-rich repeat 325..348 CDD:275380 6/22 (27%)
LRR_RI 327..567 CDD:238064 64/332 (19%)
leucine-rich repeat 349..371 CDD:275380 6/52 (12%)
LRR_8 370..425 CDD:290566 17/67 (25%)
leucine-rich repeat 372..393 CDD:275380 5/24 (21%)
leucine-rich repeat 394..415 CDD:275380 4/20 (20%)
leucine-rich repeat 418..486 CDD:275380 21/95 (22%)
leucine-rich repeat 441..464 CDD:275378 6/22 (27%)
LRR_8 487..545 CDD:290566 16/78 (21%)
leucine-rich repeat 487..510 CDD:275380 4/22 (18%)
leucine-rich repeat 511..534 CDD:275380 8/43 (19%)
LRR_8 533..589 CDD:290566 17/62 (27%)
leucine-rich repeat 535..558 CDD:275380 5/22 (23%)
leucine-rich repeat 559..580 CDD:275380 7/24 (29%)
7tm_4 764..>892 CDD:304433
7tm_1 770..1017 CDD:278431
PHLPP1NP_919431.2 leucine-rich repeat 1107..1129 CDD:275380 7/35 (20%)
PP2Cc 1168..1420 CDD:214625
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1458..1510
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1673..1717
PDZ-binding, required for interaction with SLC9A3R1. /evidence=ECO:0000269|PubMed:21804599 1715..1717
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..25
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 41..118
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 136..156
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 252..470 18/88 (20%)
PH_PHLPP-like 535..631 CDD:270131 12/96 (13%)
PH 555..636 CDD:278594 11/86 (13%)
LRR_RI 625..929 CDD:238064 69/317 (22%)
LRR_8 638..703 CDD:290566 19/66 (29%)
LRR 1 638..659 7/21 (33%)
leucine-rich repeat 641..661 CDD:275380 7/20 (35%)
LRR 2 661..682 5/21 (24%)
leucine-rich repeat 662..692 CDD:275380 6/30 (20%)
LRR 3 692..712 8/20 (40%)
leucine-rich repeat 693..738 CDD:275380 14/46 (30%)
LRR_8 714..770 CDD:290566 17/57 (30%)
LRR 4 715..736 7/21 (33%)
LRR 5 738..760 7/22 (32%)
leucine-rich repeat 739..761 CDD:275380 7/22 (32%)
LRR 6 761..783 6/21 (29%)
leucine-rich repeat 762..784 CDD:275380 6/21 (29%)
LRR 7 784..804 0/19 (0%)
leucine-rich repeat 785..808 CDD:275380 1/22 (5%)
LRR 8 808..831 5/22 (23%)
leucine-rich repeat 810..832 CDD:275380 6/21 (29%)
LRR_RI 814..1074 CDD:238064 53/264 (20%)
LRR 9 832..853 4/20 (20%)
leucine-rich repeat 833..853 CDD:275380 4/19 (21%)
leucine-rich repeat 854..895 CDD:275380 3/40 (8%)
LRR 10 873..894 3/20 (15%)
LRR 11 895..916 5/20 (25%)
leucine-rich repeat 896..918 CDD:275380 5/24 (21%)
LRR 12 918..939 4/21 (19%)
leucine-rich repeat 919..941 CDD:275380 4/22 (18%)
LRR 13 941..962 8/21 (38%)
leucine-rich repeat 942..963 CDD:275380 8/21 (38%)
LRR_8 962..1024 CDD:290566 10/61 (16%)
LRR 14 963..984 6/20 (30%)
leucine-rich repeat 964..987 CDD:275380 6/22 (27%)
LRR 15 987..1008 4/20 (20%)
leucine-rich repeat 988..1011 CDD:275380 4/22 (18%)
LRR 16 1013..1033 2/19 (11%)
LRR_8 1014..1072 CDD:290566 11/57 (19%)
leucine-rich repeat 1014..1037 CDD:275380 3/22 (14%)
LRR 17 1037..1058 3/20 (15%)
leucine-rich repeat 1038..1061 CDD:275380 4/22 (18%)
LRR 18 1061..1082 7/20 (35%)
Interaction with SLC9A3R1. /evidence=ECO:0000269|PubMed:21804599 1076..1205 22/103 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.