DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rk and let-4

DIOPT Version :9

Sequence 1:NP_476702.1 Gene:rk / 34819 FlyBaseID:FBgn0003255 Length:1360 Species:Drosophila melanogaster
Sequence 2:NP_510425.2 Gene:let-4 / 181554 WormBaseID:WBGene00002282 Length:773 Species:Caenorhabditis elegans


Alignment Length:636 Identity:148/636 - (23%)
Similarity:257/636 - (40%) Gaps:102/636 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 SCRGIGILAVPVNLPNEVVVLDLGNNN---LTKLEANSFFMAPNLEELTLSDNSIINMDPNAFYG 225
            :|.|:...|...:..:..:|||..|::   :.::...:......::.||::...::.:.||.|.|
 Worm    20 ACPGVITQACFCSEVHSGIVLDCSNSSASGILQIIRTNQAQVGLIQSLTMNQAELVELPPNFFSG 84

  Fly   226 LAKLKRLSLQNCGLKSLPPQSFQGLAQLTSLQLNGNALVSLDGDCLGHLQKLRTLRLEGNLFYRI 290
            |. ::||.|....:|.:...:|.|:..:                       |..:.|..||..::
 Worm    85 LF-IRRLDLSQNKIKKIDDAAFAGINPV-----------------------LEEVVLNHNLIEKV 125

  Fly   291 PTNALAGLRTLEALNLGSNLLTIINDED-FPRMPNLIVLLLKRNQIMKISAGALKNL-TALKVLE 353
            |..|||||..|..|:|.:|.:..|.::: ||.:..|..:.|..|:|..|.....:|: .:::.:.
 Worm   126 PAAALAGLPNLLRLDLSNNSIVEIQEQEIFPNLNKLYDINLGSNKIFSIHTSTFQNVKNSIQTIN 190

  Fly   354 LDDNLISSLP-EGLSKLSQLQELSITSNRLRW---INDTELPRSMQMLDMRANPLSTISPGAFRG 414
            |..|.::::| ..:..|.|||.|.:..||:..   :|...|| .:.:|::..|.:..::..||..
 Worm   191 LGHNNMTAVPSSAIRGLKQLQSLHLHKNRIEQLDALNFLNLP-VLNLLNLAGNQIHELNRQAFLN 254

  Fly   415 MSKLRKLILS--DVRTLRSFPELEACHALEILKLDRAGIQEVPANLCRQTPRLKSLELKTNSLKR 477
            :..||.|.||  .:..|.:: :.:....||:|.|....|..:|||......:|:.|.|..|.:..
 Worm   255 VPSLRYLYLSGNKITKLTAY-QFQTFEQLEMLDLTNNEIGAIPANSLSGLKQLRQLYLAHNKISN 318

  Fly   478 I-PNLSSCRDLRLLDLSSNQIEKIQGKPFNGLKQLNDLLLSYNRIKALPQDAFQGIPKLQLLDLE 541
            | .|..:...:.:|.||||:::.:.....:||..|..:....|:||.:.::||.....|.:|||.
 Worm   319 ISSNAFTNSSIVVLVLSSNELKTLTAGIISGLPNLQQVSFRDNQIKTINRNAFYDAASLVMLDLA 383

  Fly   542 GNEISYIHKEAFSGFTALEDLNLGNNIFPELPESGLRA---LLHLKTFNNP-------------- 589
            .|:::.|....|.....|..::|..|..|:.|.|...:   .:.||  .||              
 Worm   384 KNQLTEIAPTTFLAQLNLLLVDLSENKLPKTPYSAFNSRVGTVLLK--ENPLVCTENLHMLQQGT 446

  Fly   590 --------------KLREFPPPDTFPRIQTLILSYAYHCCAFLPLVAMSSQKKTSQVQEAVLFPS 640
                          |....|.|...|.:...::|........:|.:.:.....|:...:|...||
 Worm   447 GVYVRDSPDIICGRKPTPKPEPVLVPIVTDSLISTQRPALVQIPKMQIHRNVHTTTGDQAPQIPS 511

  Fly   641 DAEFDMTLWNNSMMNIWPQMHN---LSKQLGASMHDPWETAINFNEEQLQTQ------TGGQIAT 696
            .|...:.|..:..:   |:.|:   |.|.      ...|.::...||....|      ...:|..
 Worm   512 GAFQQIDLGKSRSL---PRGHSRFILDKP------STREQSVEPTEELTPIQPIILPSREDEIRQ 567

  Fly   697 SYMEEYFEEHDVSGPATGYGFGTGLFSGMSTEDF--QPGSVQCLPMPGPFL 745
            |.||....:..|.  ||....       .||.|.  :|..|  ||.|.|||
 Worm   568 SSMEAGTSQESVE--ATSQKI-------PSTTDIIDRPNVV--LPFPVPFL 607

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rkNP_476702.1 leucine-rich repeat 158..179 CDD:275380 3/14 (21%)
LRR_RI 180..>383 CDD:238064 50/208 (24%)
leucine-rich repeat 183..204 CDD:275380 4/23 (17%)
LRR_8 203..263 CDD:290566 13/59 (22%)
leucine-rich repeat 205..228 CDD:275380 7/22 (32%)
leucine-rich repeat 229..252 CDD:275380 6/22 (27%)
LRR_8 252..311 CDD:290566 14/58 (24%)
leucine-rich repeat 253..276 CDD:275380 0/22 (0%)
leucine-rich repeat 277..300 CDD:275380 10/22 (45%)
LRR_8 299..359 CDD:290566 15/61 (25%)
leucine-rich repeat 301..324 CDD:275380 7/23 (30%)
leucine-rich repeat 325..348 CDD:275380 6/23 (26%)
LRR_RI 327..567 CDD:238064 64/247 (26%)
leucine-rich repeat 349..371 CDD:275380 4/22 (18%)
LRR_8 370..425 CDD:290566 18/59 (31%)
leucine-rich repeat 372..393 CDD:275380 8/23 (35%)
leucine-rich repeat 394..415 CDD:275380 4/20 (20%)
leucine-rich repeat 418..486 CDD:275380 20/70 (29%)
leucine-rich repeat 441..464 CDD:275378 8/22 (36%)
LRR_8 487..545 CDD:290566 18/57 (32%)
leucine-rich repeat 487..510 CDD:275380 7/22 (32%)
leucine-rich repeat 511..534 CDD:275380 6/22 (27%)
LRR_8 533..589 CDD:290566 15/58 (26%)
leucine-rich repeat 535..558 CDD:275380 7/22 (32%)
leucine-rich repeat 559..580 CDD:275380 6/23 (26%)
7tm_4 764..>892 CDD:304433
7tm_1 770..1017 CDD:278431
let-4NP_510425.2 leucine-rich repeat 66..86 CDD:275380 6/19 (32%)
LRR_RI <71..275 CDD:238064 57/229 (25%)
LRR_8 88..146 CDD:290566 20/80 (25%)
leucine-rich repeat 88..111 CDD:275380 6/22 (27%)
leucine-rich repeat 112..135 CDD:275380 10/22 (45%)
leucine-rich repeat 136..160 CDD:275380 7/23 (30%)
LRR_8 156..220 CDD:290566 16/63 (25%)
leucine-rich repeat 161..184 CDD:275380 6/22 (27%)
leucine-rich repeat 186..209 CDD:275380 4/22 (18%)
leucine-rich repeat 210..257 CDD:275380 12/47 (26%)
LRR_RI <250..411 CDD:238064 45/161 (28%)
LRR_8 256..316 CDD:290566 18/60 (30%)
leucine-rich repeat 258..281 CDD:275380 6/23 (26%)
leucine-rich repeat 282..305 CDD:275380 8/22 (36%)
leucine-rich repeat 306..328 CDD:275380 6/21 (29%)
LRR_8 327..387 CDD:290566 18/59 (31%)
leucine-rich repeat 329..350 CDD:275380 5/20 (25%)
leucine-rich repeat 353..400 CDD:275380 13/46 (28%)
leucine-rich repeat 356..376 CDD:275380 5/19 (26%)
leucine-rich repeat 401..419 CDD:275380 6/17 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.