DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rk and Y54E10A.6

DIOPT Version :9

Sequence 1:NP_476702.1 Gene:rk / 34819 FlyBaseID:FBgn0003255 Length:1360 Species:Drosophila melanogaster
Sequence 2:NP_001380012.1 Gene:Y54E10A.6 / 171890 WormBaseID:WBGene00021828 Length:507 Species:Caenorhabditis elegans


Alignment Length:422 Identity:109/422 - (25%)
Similarity:175/422 - (41%) Gaps:96/422 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 EVVVLDLGNNNLTKLEANSFFMAPNLEELTLSDNSIINMDPNAFYGLAKLKRLSLQNCGLKSLPP 244
            |:|:.::..:::|:        |.||.:            ...|..:::|..|||..|.|.:| .
 Worm    18 EIVIKNVRIDSVTE--------AANLSQ------------KRVFESMSQLNLLSLTGCSLHNL-S 61

  Fly   245 QSFQGLAQLTSLQLNGNALVSLDG--DCLGHLQKLRTLRLEGNLFYRIPTNALAGLRTLEALNLG 307
            .|.:..:.|..|.|..|.|..|..  ||   |.||:.:.|..|....:|. :::....||:|.|.
 Worm    62 SSIRSCSNLMHLVLPKNDLKQLPDVFDC---LPKLKFMDLSHNHLDALPA-SISKCENLESLILN 122

  Fly   308 SNLLTIINDEDFP---RMPNLIVLLLKRNQIMKISAGALK-NLTA-LKVLELDDNLISSLPEGLS 367
            :|.|   |:..||   .:.||.:.....|.|.||.|.... ||:| |..:.|..|.|..:|:.||
 Worm   123 NNRL---NESSFPDISNLSNLHIFDAAHNTISKIPASLTSHNLSAKLHTIILSHNSIEVIPDSLS 184

  Fly   368 KLSQLQELSITSNRLRWIND--TELPRSMQMLDMRANPLSTISPGAFRGMSKLRKLILSDVRTLR 430
            .|.||:||.|..|:|:.:..  ..||: :::||:..|..|.         |:.:|| .:|.|   
 Worm   185 NLKQLKELKIDENKLKDVPSVIAHLPK-LKVLDISKNCFSE---------SRFQKL-ANDKR--- 235

  Fly   431 SFPELEACHAL------------EILKLDRAGIQEVPANLCRQTPRLKSLELKTNSLKRIPNLSS 483
              .:|.|..||            |..|...:|..:.|.   ...|......::..:::|.|::|.
 Worm   236 --GKLNAVIALAQKIGKPIGNSEEQKKAPESGSPDFPV---PDAPLTVRTGIENLTVRRHPSVSE 295

  Fly   484 CRDLRLLDLSSNQIEKIQG---KPFNGLK-QLNDLLLSYNR-IKALPQ---DAFQ------GIPK 534
            .|.. |:....|.::...|   |.|..|: :::...|..|| :.|:..   |:||      .:||
 Worm   296 IRPY-LVCCVINNVDLNGGDSFKKFIALQTKMHASALCENRTLSAIGTHRLDSFQLPLCYMALPK 359

  Fly   535 LQLLDLEGNEISYIH----KEAFSGFTALEDL 562
            .:|         ||.    |.:.|....|:.|
 Worm   360 DEL---------YIRALNKKSSVSASELLDSL 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rkNP_476702.1 leucine-rich repeat 158..179 CDD:275380
LRR_RI 180..>383 CDD:238064 62/209 (30%)
leucine-rich repeat 183..204 CDD:275380 2/20 (10%)
LRR_8 203..263 CDD:290566 15/59 (25%)
leucine-rich repeat 205..228 CDD:275380 2/22 (9%)
leucine-rich repeat 229..252 CDD:275380 8/22 (36%)
LRR_8 252..311 CDD:290566 19/60 (32%)
leucine-rich repeat 253..276 CDD:275380 9/24 (38%)
leucine-rich repeat 277..300 CDD:275380 4/22 (18%)
LRR_8 299..359 CDD:290566 22/64 (34%)
leucine-rich repeat 301..324 CDD:275380 9/25 (36%)
leucine-rich repeat 325..348 CDD:275380 8/23 (35%)
LRR_RI 327..567 CDD:238064 69/270 (26%)
leucine-rich repeat 349..371 CDD:275380 8/21 (38%)
LRR_8 370..425 CDD:290566 16/56 (29%)
leucine-rich repeat 372..393 CDD:275380 8/22 (36%)
leucine-rich repeat 394..415 CDD:275380 4/20 (20%)
leucine-rich repeat 418..486 CDD:275380 16/79 (20%)
leucine-rich repeat 441..464 CDD:275378 5/34 (15%)
LRR_8 487..545 CDD:290566 16/71 (23%)
leucine-rich repeat 487..510 CDD:275380 6/26 (23%)
leucine-rich repeat 511..534 CDD:275380 7/32 (22%)
LRR_8 533..589 CDD:290566 9/34 (26%)
leucine-rich repeat 535..558 CDD:275380 5/26 (19%)
leucine-rich repeat 559..580 CDD:275380 2/4 (50%)
7tm_4 764..>892 CDD:304433
7tm_1 770..1017 CDD:278431
Y54E10A.6NP_001380012.1 LRR <45..>219 CDD:227223 60/182 (33%)
leucine-rich repeat 47..69 CDD:275380 8/22 (36%)
leucine-rich repeat 70..92 CDD:275380 9/24 (38%)
leucine-rich repeat 93..115 CDD:275380 4/22 (18%)
leucine-rich repeat 116..139 CDD:275380 9/25 (36%)
leucine-rich repeat 140..164 CDD:275380 8/23 (35%)
leucine-rich repeat 166..188 CDD:275380 8/21 (38%)
leucine-rich repeat 189..211 CDD:275380 7/21 (33%)
PLN02265 266..>495 CDD:215149 28/130 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.