DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rk and iglr-3

DIOPT Version :9

Sequence 1:NP_476702.1 Gene:rk / 34819 FlyBaseID:FBgn0003255 Length:1360 Species:Drosophila melanogaster
Sequence 2:NP_001293349.1 Gene:iglr-3 / 171771 WormBaseID:WBGene00021353 Length:488 Species:Caenorhabditis elegans


Alignment Length:317 Identity:85/317 - (26%)
Similarity:127/317 - (40%) Gaps:77/317 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   201 MAPNLEELTLSDNSI--INMDPNAFYGLAKLKRLSLQNCGLKSLPPQSFQGLAQLTSLQLNGNAL 263
            :.||:..|:||:|||  |...|:.:   .:|:.|.|..|.|:.|...:.....||..|.::.|:|
 Worm    47 LLPNVLSLSLSNNSIFRITTFPSEY---RRLQSLRLDQCQLEKLDFDALSVFEQLRELDVSRNSL 108

  Fly   264 VSLDGDCLGHLQKLRTLRLEGNLFYRIPTNALAGLRTLEALNLGSNLLTIINDEDFPRM-P-NLI 326
            ..|  ....:|..||.|.|..|.|..:|.  ::.|.:|..::|..|.|..:.    ||| | ||.
 Worm   109 SKL--IIPRNLASLRVLNLAFNAFTYVPD--MSHLESLRLVDLSHNRLISVR----PRMLPFNLE 165

  Fly   327 VLLLKRNQIMKISAGALKNLTALKVLELDDNLISSLPEGLSKLSQLQELSITSNRLRWINDTELP 391
            |:.|..|:...:|....                         |.:||||.:|      .||.|..
 Worm   166 VVRLAANRFQHLSPWPF-------------------------LHKLQELDVT------FNDLECD 199

  Fly   392 RSMQMLDMRANPL----STISPGAFRGMSKLRKLILSDVRT------LRSFPELEACHALEILKL 446
            .|:......|..|    ||:.|  .|..|:|||..: |.:|      :.|.||      ..::.|
 Worm   200 CSLWHFVTWAEKLALFDSTMLP--CRRPSELRKSPI-DGKTVCGPTVVTSSPE------SAVVSL 255

  Fly   447 DRAGIQEVPANLCRQTPRL------KSLE--LKTNSLKRIPNLSSCRDL---RLLDL 492
            |.|.:....| |...:|:|      |::.  |....|.....|..|.::   ||.|:
 Worm   256 DDAHVMCCTA-LATPSPQLYWQFNGKNISSGLSQKHLSESGKLEFCLEIPKVRLKDM 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rkNP_476702.1 leucine-rich repeat 158..179 CDD:275380
LRR_RI 180..>383 CDD:238064 51/185 (28%)
leucine-rich repeat 183..204 CDD:275380 0/2 (0%)
LRR_8 203..263 CDD:290566 20/61 (33%)
leucine-rich repeat 205..228 CDD:275380 8/24 (33%)
leucine-rich repeat 229..252 CDD:275380 6/22 (27%)
LRR_8 252..311 CDD:290566 18/58 (31%)
leucine-rich repeat 253..276 CDD:275380 6/22 (27%)
leucine-rich repeat 277..300 CDD:275380 8/22 (36%)
LRR_8 299..359 CDD:290566 14/61 (23%)
leucine-rich repeat 301..324 CDD:275380 8/24 (33%)
leucine-rich repeat 325..348 CDD:275380 5/22 (23%)
LRR_RI 327..567 CDD:238064 44/187 (24%)
leucine-rich repeat 349..371 CDD:275380 1/21 (5%)
LRR_8 370..425 CDD:290566 19/58 (33%)
leucine-rich repeat 372..393 CDD:275380 8/20 (40%)
leucine-rich repeat 394..415 CDD:275380 6/24 (25%)
leucine-rich repeat 418..486 CDD:275380 20/81 (25%)
leucine-rich repeat 441..464 CDD:275378 5/22 (23%)
LRR_8 487..545 CDD:290566 3/9 (33%)
leucine-rich repeat 487..510 CDD:275380 3/9 (33%)
leucine-rich repeat 511..534 CDD:275380
LRR_8 533..589 CDD:290566
leucine-rich repeat 535..558 CDD:275380
leucine-rich repeat 559..580 CDD:275380
7tm_4 764..>892 CDD:304433
7tm_1 770..1017 CDD:278431
iglr-3NP_001293349.1 LRR <47..>196 CDD:227223 52/190 (27%)
leucine-rich repeat 51..73 CDD:275380 8/24 (33%)
leucine-rich repeat 74..97 CDD:275380 6/22 (27%)
leucine-rich repeat 98..119 CDD:275380 6/22 (27%)
leucine-rich repeat 120..141 CDD:275380 8/22 (36%)
leucine-rich repeat 142..163 CDD:275380 8/24 (33%)
leucine-rich repeat 164..185 CDD:275380 6/45 (13%)
Ig_3 243..319 CDD:372822 18/76 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.