Sequence 1: | NP_476702.1 | Gene: | rk / 34819 | FlyBaseID: | FBgn0003255 | Length: | 1360 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_032403.2 | Gene: | Lrig1 / 16206 | MGIID: | 107935 | Length: | 1091 | Species: | Mus musculus |
Alignment Length: | 446 | Identity: | 130/446 - (29%) |
---|---|---|---|
Similarity: | 199/446 - (44%) | Gaps: | 70/446 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 152 CHCTGSLEVLRLSCRGIGILAVPVNLPNEVVVLDLGNNNLTKLEANSFFMAPNLEELTLSDNSII 216
Fly 217 NMDPNAFYGLAKLKRLSLQNCGLKSLPPQSFQGLAQLTSLQLNGNALVSLDGDCLGHLQKLRTLR 281
Fly 282 LEGNLFYRIPTNALAGLRTLEALNLGSNLLTIINDEDFPRMPNLIVLLLKRNQIMKISAGALKNL 346
Fly 347 T-ALKVLELDDNLISSLPEGLSKLSQLQELSITSNRLRWINDTELP--RSMQMLDMRANPLSTIS 408
Fly 409 PGAFRGMSKLRKLILS-----DVRTLRSFPELEACHALEILKLDRAGIQEVPANLCRQTPRLKSL 468
Fly 469 ELKTNSLKRI--PNLSSCRDLRLLDLSSNQIEKIQGKPFNGLKQLNDLLLSYNRIKALPQD---A 528
Fly 529 FQGIPKLQLLDLEGNEISYIHKEAFSGFTALEDLNLGNNIFPELPESGLRALLHLK 584 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
rk | NP_476702.1 | leucine-rich repeat | 158..179 | CDD:275380 | 6/20 (30%) |
LRR_RI | 180..>383 | CDD:238064 | 50/203 (25%) | ||
leucine-rich repeat | 183..204 | CDD:275380 | 5/20 (25%) | ||
LRR_8 | 203..263 | CDD:290566 | 11/59 (19%) | ||
leucine-rich repeat | 205..228 | CDD:275380 | 4/22 (18%) | ||
leucine-rich repeat | 229..252 | CDD:275380 | 2/22 (9%) | ||
LRR_8 | 252..311 | CDD:290566 | 14/58 (24%) | ||
leucine-rich repeat | 253..276 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 277..300 | CDD:275380 | 1/22 (5%) | ||
LRR_8 | 299..359 | CDD:290566 | 21/60 (35%) | ||
leucine-rich repeat | 301..324 | CDD:275380 | 10/22 (45%) | ||
leucine-rich repeat | 325..348 | CDD:275380 | 7/23 (30%) | ||
LRR_RI | 327..567 | CDD:238064 | 87/252 (35%) | ||
leucine-rich repeat | 349..371 | CDD:275380 | 9/21 (43%) | ||
LRR_8 | 370..425 | CDD:290566 | 18/61 (30%) | ||
leucine-rich repeat | 372..393 | CDD:275380 | 6/22 (27%) | ||
leucine-rich repeat | 394..415 | CDD:275380 | 6/20 (30%) | ||
leucine-rich repeat | 418..486 | CDD:275380 | 18/74 (24%) | ||
leucine-rich repeat | 441..464 | CDD:275378 | 4/22 (18%) | ||
LRR_8 | 487..545 | CDD:290566 | 25/60 (42%) | ||
leucine-rich repeat | 487..510 | CDD:275380 | 10/22 (45%) | ||
leucine-rich repeat | 511..534 | CDD:275380 | 9/25 (36%) | ||
LRR_8 | 533..589 | CDD:290566 | 20/52 (38%) | ||
leucine-rich repeat | 535..558 | CDD:275380 | 11/22 (50%) | ||
leucine-rich repeat | 559..580 | CDD:275380 | 7/20 (35%) | ||
7tm_4 | 764..>892 | CDD:304433 | |||
7tm_1 | 770..1017 | CDD:278431 | |||
Lrig1 | NP_032403.2 | leucine-rich repeat | 53..71 | CDD:275380 | 7/17 (41%) |
LRR_RI | 57..325 | CDD:238064 | 84/320 (26%) | ||
LRR 1 | 71..92 | 5/20 (25%) | |||
leucine-rich repeat | 72..95 | CDD:275380 | 5/22 (23%) | ||
LRR_8 | 73..129 | CDD:290566 | 16/80 (20%) | ||
LRR 2 | 95..116 | 6/36 (17%) | |||
LRR 3 | 118..139 | 8/44 (18%) | |||
LRR_8 | 142..225 | CDD:290566 | 29/82 (35%) | ||
LRR 4 | 142..163 | 9/20 (45%) | |||
leucine-rich repeat | 143..166 | CDD:275380 | 10/22 (45%) | ||
LRR 5 | 166..187 | 6/20 (30%) | |||
leucine-rich repeat | 167..190 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 191..214 | CDD:275380 | 9/22 (41%) | ||
LRR 6 | 191..212 | 7/20 (35%) | |||
LRR_8 | 213..273 | CDD:290566 | 18/59 (31%) | ||
LRR 7 | 214..235 | 6/20 (30%) | |||
leucine-rich repeat | 215..238 | CDD:275380 | 6/22 (27%) | ||
LRR_RI | 238..>423 | CDD:238064 | 66/188 (35%) | ||
LRR 8 | 238..259 | 7/20 (35%) | |||
leucine-rich repeat | 239..262 | CDD:275380 | 7/22 (32%) | ||
LRR_8 | 261..321 | CDD:290566 | 17/63 (27%) | ||
LRR 9 | 262..283 | 5/21 (24%) | |||
leucine-rich repeat | 263..286 | CDD:275380 | 5/23 (22%) | ||
LRR 10 | 286..307 | 5/20 (25%) | |||
leucine-rich repeat | 287..310 | CDD:275380 | 5/25 (20%) | ||
LRR_8 | 310..369 | CDD:290566 | 22/58 (38%) | ||
LRR 11 | 310..331 | 7/20 (35%) | |||
leucine-rich repeat | 311..334 | CDD:275380 | 7/22 (32%) | ||
LRR 12 | 334..355 | 8/20 (40%) | |||
leucine-rich repeat | 335..358 | CDD:275380 | 10/22 (45%) | ||
LRR 13 | 358..380 | 6/21 (29%) | |||
leucine-rich repeat | 359..383 | CDD:275380 | 8/23 (35%) | ||
LRR_8 | 385..441 | CDD:290566 | 20/51 (39%) | ||
LRR 14 | 385..406 | 9/20 (45%) | |||
leucine-rich repeat | 386..409 | CDD:275380 | 11/22 (50%) | ||
LRR 15 | 409..430 | 7/20 (35%) | |||
leucine-rich repeat | 410..433 | CDD:275380 | 7/22 (32%) | ||
LRRCT | 444..492 | CDD:214507 | |||
Ig_3 | 496..583 | CDD:290638 | |||
I-set | 497..597 | CDD:254352 | |||
I-set | 601..691 | CDD:254352 | |||
Ig_1 | 618..692 | CDD:143240 | |||
I-set | 695..782 | CDD:254352 | |||
IGc2 | 709..772 | CDD:197706 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 912..990 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1059..1091 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |