Sequence 1: | NP_476702.1 | Gene: | rk / 34819 | FlyBaseID: | FBgn0003255 | Length: | 1360 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_320129.3 | Gene: | AgaP_AGAP012425 / 1280456 | VectorBaseID: | AGAP012425 | Length: | 472 | Species: | Anopheles gambiae |
Alignment Length: | 328 | Identity: | 94/328 - (28%) |
---|---|---|---|
Similarity: | 143/328 - (43%) | Gaps: | 72/328 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 248 QGLAQLTSLQLNGNALVSLDGDCLGHLQKLRTLRLEGNLFYRIPTNALAGLRTLEALNLGSNLLT 312
Fly 313 IINDEDFPRMPNLIVLLLKRNQIMKISAGALKNLTALKVLELDDNLISSLPEGLS---------- 367
Fly 368 ----KLSQLQELSITSNRLRWIND---TELPRSMQMLDMRANPLSTISPGAFRGMSKLRKLILSD 425
Fly 426 VRTLRSFPELEACHALEILKLDRAGIQEVPANLCRQTPR-LKSLELKTNSLKRIP-NLSSCRDLR 488
Fly 489 LLDLSSNQIEKI-QGKPFNGLKQLNDLLLSY-NRIKALPQDAFQGIPKLQLLDLEGN-EISYIHK 550
Fly 551 EAF 553 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
rk | NP_476702.1 | leucine-rich repeat | 158..179 | CDD:275380 | |
LRR_RI | 180..>383 | CDD:238064 | 40/148 (27%) | ||
leucine-rich repeat | 183..204 | CDD:275380 | |||
LRR_8 | 203..263 | CDD:290566 | 5/14 (36%) | ||
leucine-rich repeat | 205..228 | CDD:275380 | |||
leucine-rich repeat | 229..252 | CDD:275380 | 1/3 (33%) | ||
LRR_8 | 252..311 | CDD:290566 | 14/58 (24%) | ||
leucine-rich repeat | 253..276 | CDD:275380 | 6/22 (27%) | ||
leucine-rich repeat | 277..300 | CDD:275380 | 7/22 (32%) | ||
LRR_8 | 299..359 | CDD:290566 | 17/59 (29%) | ||
leucine-rich repeat | 301..324 | CDD:275380 | 3/22 (14%) | ||
leucine-rich repeat | 325..348 | CDD:275380 | 7/22 (32%) | ||
LRR_RI | 327..567 | CDD:238064 | 75/249 (30%) | ||
leucine-rich repeat | 349..371 | CDD:275380 | 9/35 (26%) | ||
LRR_8 | 370..425 | CDD:290566 | 13/57 (23%) | ||
leucine-rich repeat | 372..393 | CDD:275380 | 7/23 (30%) | ||
leucine-rich repeat | 394..415 | CDD:275380 | 4/20 (20%) | ||
leucine-rich repeat | 418..486 | CDD:275380 | 19/69 (28%) | ||
leucine-rich repeat | 441..464 | CDD:275378 | 3/22 (14%) | ||
LRR_8 | 487..545 | CDD:290566 | 23/60 (38%) | ||
leucine-rich repeat | 487..510 | CDD:275380 | 9/23 (39%) | ||
leucine-rich repeat | 511..534 | CDD:275380 | 9/23 (39%) | ||
LRR_8 | 533..589 | CDD:290566 | 7/22 (32%) | ||
leucine-rich repeat | 535..558 | CDD:275380 | 7/20 (35%) | ||
leucine-rich repeat | 559..580 | CDD:275380 | |||
7tm_4 | 764..>892 | CDD:304433 | |||
7tm_1 | 770..1017 | CDD:278431 | |||
AgaP_AGAP012425 | XP_320129.3 | LRR_RI | <55..267 | CDD:238064 | 71/255 (28%) |
LRR_8 | 76..146 | CDD:290566 | 22/71 (31%) | ||
leucine-rich repeat | 77..100 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 101..135 | CDD:275380 | 9/35 (26%) | ||
LRR_8 | 134..194 | CDD:290566 | 14/64 (22%) | ||
leucine-rich repeat | 136..159 | CDD:275380 | 7/23 (30%) | ||
leucine-rich repeat | 160..186 | CDD:275380 | 4/25 (16%) | ||
LRR_8 | 186..244 | CDD:290566 | 23/78 (29%) | ||
leucine-rich repeat | 187..210 | CDD:275380 | 10/43 (23%) | ||
leucine-rich repeat | 211..233 | CDD:275380 | 8/21 (38%) | ||
leucine-rich repeat | 234..258 | CDD:275380 | 9/23 (39%) | ||
LRR_8 | 257..329 | CDD:290566 | 18/47 (38%) | ||
leucine-rich repeat | 259..283 | CDD:275380 | 9/23 (39%) | ||
leucine-rich repeat | 284..305 | CDD:275380 | 7/20 (35%) | ||
leucine-rich repeat | 343..355 | CDD:275378 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |