DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rk and AgaP_AGAP012317

DIOPT Version :9

Sequence 1:NP_476702.1 Gene:rk / 34819 FlyBaseID:FBgn0003255 Length:1360 Species:Drosophila melanogaster
Sequence 2:XP_320227.3 Gene:AgaP_AGAP012317 / 1280380 VectorBaseID:AGAP012317 Length:458 Species:Anopheles gambiae


Alignment Length:425 Identity:108/425 - (25%)
Similarity:163/425 - (38%) Gaps:122/425 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 DMQNSQEQEPYVHL---------QHLQQQQQQNPQTVQQLSQITVNRTSKSASVTPTGIRENVML 99
            |:.||....|.|.:         :..|:..:|.||     ..:.::.:..:.:|.|..:.|    
Mosquito    36 DVHNSPTGLPEVQIDCRKHQLGDEFWQESSEQMPQ-----GTVRLDLSRNALTVVPRLVGE---- 91

  Fly   100 PSADPEKEAQILYEKSLQEYHGSQLSTASTATDVIAGKRTLHSICERWLQKHCHCTGSLEVLRLS 164
                     |:.|   |...|    :..:|..|.:.|..:|                 ||.|.||
Mosquito    92 ---------QLRY---LNLGH----NQITTIPDKVFGNVSL-----------------LEELDLS 123

  Fly   165 CRGIGILAVP--VNLPNEVVVLDLGNNNLTKLEANSFFMAPNLEELTLSDNSIINMDPNAFYGLA 227
            ...|.:|...  ..||| :.::||.:|.:||:|.|:|..|.:|.:|.||:||:     .||:...
Mosquito   124 SNRIEMLGTDALAGLPN-LKLIDLSSNLITKIEVNAFSNALHLSQLKLSNNSL-----GAFFNRT 182

  Fly   228 ------------KLKRLSLQNCGLKSLPPQSFQGL-----------------AQLTSLQLNGNAL 263
                        :|..|.::.|.|..:...|..||                 .||..|.::|..:
Mosquito   183 EADLYLRLGVTNRLAVLEMERCNLTDINLSSGVGLERALLGYNRLQQLSKLPKQLAYLDISGTPI 247

  Fly   264 VSLDGDCLGHLQKLRTLRLEG-NLFYRIPTNALAGLRTLEALNL-GSNLLTIINDEDFPRMPNLI 326
            .||....|.||..|.:|.|:. .:.|.:...||.||..|..||| ||..|:.|:...|.:  |:|
Mosquito   248 RSLPAKFLPHLLHLESLILQDMPILYTLEEYALYGLPRLSMLNLQGSRNLSTIHPHVFGQ--NVI 310

  Fly   327 VLLLKRNQIMKISAGALKNLTALKVLELDDNLISSLPEGLS-KLSQLQELSITSN------RLRW 384
                 ||:          ..|.||.|.|....|.:|...|. ....|:.|.|...      :|||
Mosquito   311 -----RNE----------TDTELKRLILKGTNIRTLNSTLQFAFENLRLLDIRGAPLRCDCQLRW 360

  Fly   385 INDTELPRSMQM-LDMRANPL-----STISPGAFR 413
            :.  |||..|.: :.::.|.|     .||.|..|:
Mosquito   361 LR--ELPNLMTLGVCVKPNALRDKRFGTIDPHQFQ 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rkNP_476702.1 leucine-rich repeat 158..179 CDD:275380 8/22 (36%)
LRR_RI 180..>383 CDD:238064 65/240 (27%)
leucine-rich repeat 183..204 CDD:275380 9/20 (45%)
LRR_8 203..263 CDD:290566 19/88 (22%)
leucine-rich repeat 205..228 CDD:275380 8/34 (24%)
leucine-rich repeat 229..252 CDD:275380 7/39 (18%)
LRR_8 252..311 CDD:290566 23/60 (38%)
leucine-rich repeat 253..276 CDD:275380 8/22 (36%)
leucine-rich repeat 277..300 CDD:275380 8/23 (35%)
LRR_8 299..359 CDD:290566 18/60 (30%)
leucine-rich repeat 301..324 CDD:275380 9/23 (39%)
leucine-rich repeat 325..348 CDD:275380 3/22 (14%)
LRR_RI 327..567 CDD:238064 26/100 (26%)
leucine-rich repeat 349..371 CDD:275380 7/22 (32%)
LRR_8 370..425 CDD:290566 16/56 (29%)
leucine-rich repeat 372..393 CDD:275380 9/26 (35%)
leucine-rich repeat 394..415 CDD:275380 7/26 (27%)
leucine-rich repeat 418..486 CDD:275380
leucine-rich repeat 441..464 CDD:275378
LRR_8 487..545 CDD:290566
leucine-rich repeat 487..510 CDD:275380
leucine-rich repeat 511..534 CDD:275380
LRR_8 533..589 CDD:290566
leucine-rich repeat 535..558 CDD:275380
leucine-rich repeat 559..580 CDD:275380
7tm_4 764..>892 CDD:304433
7tm_1 770..1017 CDD:278431
AgaP_AGAP012317XP_320227.3 leucine-rich repeat 74..92 CDD:275380 3/30 (10%)
LRR_8 92..151 CDD:290566 21/83 (25%)
LRR_RI <93..>177 CDD:238064 32/113 (28%)
leucine-rich repeat 93..116 CDD:275380 6/29 (21%)
LRR_4 117..155 CDD:289563 15/38 (39%)
leucine-rich repeat 117..140 CDD:275380 8/22 (36%)
LRR_8 139..206 CDD:290566 22/72 (31%)
leucine-rich repeat 141..164 CDD:275380 9/22 (41%)
leucine-rich repeat 165..195 CDD:275380 8/34 (24%)
leucine-rich repeat 217..236 CDD:275380 1/18 (6%)
LRR_8 235..295 CDD:290566 22/59 (37%)
leucine-rich repeat 237..260 CDD:275380 8/22 (36%)
leucine-rich repeat 261..285 CDD:275380 8/23 (35%)
leucine-rich repeat 342..354 CDD:275378 3/11 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.