DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rk and AgaP_AGAP009839

DIOPT Version :9

Sequence 1:NP_476702.1 Gene:rk / 34819 FlyBaseID:FBgn0003255 Length:1360 Species:Drosophila melanogaster
Sequence 2:XP_318952.3 Gene:AgaP_AGAP009839 / 1279257 VectorBaseID:AGAP009839 Length:329 Species:Anopheles gambiae


Alignment Length:246 Identity:78/246 - (31%)
Similarity:118/246 - (47%) Gaps:20/246 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   317 EDFPRMPNLIVLLLKRNQIMKISAGALKNLTALKVLELDDNLISSLPEGLSKLSQLQELSITSNR 381
            |:...:..|..|.|:.|.|.||.  .|.:||:|..|||.||.|:.| |.|..|..|:.|.::.||
Mosquito    62 ENLEPLTKLERLYLRWNLIKKIE--NLDHLTSLLELELYDNQITEL-ENLDNLVNLEMLDVSFNR 123

  Fly   382 LRWINDTELPRSMQMLDMRANPLSTISPGAFRGMSKLRKLILSDVRTLRSFPELEACHALEILKL 446
            |..|.:.....:::.|.:.||.:|.|.  .....|.|..|.|.| ..:|....|:...:|..|.|
Mosquito   124 LHQIKNLSALTNLRKLFLCANRISLIE--NLDHFSSLTMLELGD-NKIRKIENLDNLSSLTHLYL 185

  Fly   447 DRAGIQEVPANLCRQTPRLKSLELKTNSLKRIPNLSSCRDLRLLDLSSNQIEKIQGKPFNGLKQL 511
            .:..|.:: .||.:.. :|:.|.|:.|.|.:|.||....:|..|.||.|.||.|:....|  |||
Mosquito   186 GKNKITKI-ENLDKLV-KLECLSLQCNRLTKIENLDQLVNLTELYLSENGIETIENLDQN--KQL 246

  Fly   512 NDLLLSYNRIKALPQDAFQGIPKLQLLDLEGNEISYIHKEAFSGFTALEDL 562
            ..|.|:.||:|.:     :.|..|::|     |..:::....|.:|.::.|
Mosquito   247 ETLDLAKNRVKRI-----ENIEHLEML-----EEFWMNDNGVSEWTCVDKL 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rkNP_476702.1 leucine-rich repeat 158..179 CDD:275380
LRR_RI 180..>383 CDD:238064 26/65 (40%)
leucine-rich repeat 183..204 CDD:275380
LRR_8 203..263 CDD:290566
leucine-rich repeat 205..228 CDD:275380
leucine-rich repeat 229..252 CDD:275380
LRR_8 252..311 CDD:290566
leucine-rich repeat 253..276 CDD:275380
leucine-rich repeat 277..300 CDD:275380
LRR_8 299..359 CDD:290566 17/41 (41%)
leucine-rich repeat 301..324 CDD:275380 1/6 (17%)
leucine-rich repeat 325..348 CDD:275380 9/22 (41%)
LRR_RI 327..567 CDD:238064 76/236 (32%)
leucine-rich repeat 349..371 CDD:275380 11/21 (52%)
LRR_8 370..425 CDD:290566 15/54 (28%)
leucine-rich repeat 372..393 CDD:275380 6/20 (30%)
leucine-rich repeat 394..415 CDD:275380 5/20 (25%)
leucine-rich repeat 418..486 CDD:275380 20/67 (30%)
leucine-rich repeat 441..464 CDD:275378 6/22 (27%)
LRR_8 487..545 CDD:290566 20/57 (35%)
leucine-rich repeat 487..510 CDD:275380 9/22 (41%)
leucine-rich repeat 511..534 CDD:275380 7/22 (32%)
LRR_8 533..589 CDD:290566 6/30 (20%)
leucine-rich repeat 535..558 CDD:275380 4/22 (18%)
leucine-rich repeat 559..580 CDD:275380 1/4 (25%)
7tm_4 764..>892 CDD:304433
7tm_1 770..1017 CDD:278431
AgaP_AGAP009839XP_318952.3 LRR_RI 30..271 CDD:238064 75/228 (33%)
leucine-rich repeat 48..69 CDD:275380 1/6 (17%)
LRR_8 68..124 CDD:290566 24/58 (41%)
leucine-rich repeat 70..91 CDD:275380 9/22 (41%)
leucine-rich repeat 92..113 CDD:275380 11/21 (52%)
leucine-rich repeat 114..135 CDD:275380 6/20 (30%)
LRR_8 134..190 CDD:290566 15/58 (26%)
leucine-rich repeat 136..157 CDD:275380 5/22 (23%)
leucine-rich repeat 158..179 CDD:275380 6/21 (29%)
leucine-rich repeat 180..201 CDD:275380 6/22 (27%)
LRR_8 201..256 CDD:290566 23/56 (41%)
leucine-rich repeat 202..223 CDD:275380 8/20 (40%)
leucine-rich repeat 224..245 CDD:275380 9/22 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.