DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rk and AgaP_AGAP005496

DIOPT Version :9

Sequence 1:NP_476702.1 Gene:rk / 34819 FlyBaseID:FBgn0003255 Length:1360 Species:Drosophila melanogaster
Sequence 2:XP_315493.3 Gene:AgaP_AGAP005496 / 1276179 VectorBaseID:AGAP005496 Length:485 Species:Anopheles gambiae


Alignment Length:403 Identity:88/403 - (21%)
Similarity:145/403 - (35%) Gaps:109/403 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   340 AGALKNLTALKVLELDDNLISSLPEGL-SKLSQLQELSITSNRLRWINDTEL---PRSMQMLDMR 400
            |||..::|.:|   ..|:.:.:||..| ....|||||     |:.|::...:   ||.:. ||..
Mosquito    59 AGAAADVTRVK---FRDSSMVALPSSLYGAFRQLQEL-----RVWWMHLHSIHIDPRLLS-LDAE 114

  Fly   401 ANPLSTIS--PGAFRGMSKLRKLILSDVRTLRSFPELEACHALEILKLDRAGIQEVPANLCRQTP 463
            .|.:|:|:  ||.                                                  .|
Mosquito   115 KNRISSITTEPGT--------------------------------------------------VP 129

  Fly   464 RLKSLELKTNSLKRIPNLSSCRDLRLLDLSSNQIEKIQGKPFNGLKQLNDLLLSYNRIKALPQDA 528
            .|:.|||..|.|:.|.|:|...:|.:|:|:.|.:..:....|..:.:|..|.||.|.: ||.:.:
Mosquito   130 LLRKLELNQNRLRNIDNISVFENLEVLELAHNDLRTLDLCVFQRMPKLRLLDLSSNNL-ALVRSS 193

  Fly   529 F--QGIPKLQLLDLEGNEISYIHKEAFSGFTALEDLNLGNNIFPELPESGLRALLHLKTFNNPKL 591
            .  :.:..|.:|.|..|.::|:.......|.|||.::|.||....:....|..:|       |:|
Mosquito   194 IGAEKLASLTVLYLNDNRLTYLDLSILRSFPALEKVHLANNALVYVDHDSLPTML-------PRL 251

  Fly   592 REFPPPDTFPRIQTLILSYAYHCCAFLPLVAMSSQKKTSQVQ---------------EAVLFPSD 641
            |.|       .:||    ..:||.....|:   .|.:.:.||               |.:....:
Mosquito   252 RVF-------HLQT----NDWHCEGLAELI---GQLRKTGVQDFKTFSAFSCKERMVEGICCTEN 302

  Fly   642 AEFDMTLWNNSMMNIWPQMHN-----LSKQLGASMHDPWETAINFNEEQLQTQTGGQIATSYMEE 701
            ..|.:...:|..:..:....|     |.::|..:.|:......|.|..|:..|..|........:
Mosquito   303 KPFALVRKSNQYLASYTSELNGHTRHLMRELQHTRHEVARLIANDNYTQVSLQNIGDEVEELRNQ 367

  Fly   702 YFEEHDVSGPATG 714
            ..:......|.||
Mosquito   368 LTDALSSPDPVTG 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rkNP_476702.1 leucine-rich repeat 158..179 CDD:275380
LRR_RI 180..>383 CDD:238064 15/43 (35%)
leucine-rich repeat 183..204 CDD:275380
LRR_8 203..263 CDD:290566
leucine-rich repeat 205..228 CDD:275380
leucine-rich repeat 229..252 CDD:275380
LRR_8 252..311 CDD:290566
leucine-rich repeat 253..276 CDD:275380
leucine-rich repeat 277..300 CDD:275380
LRR_8 299..359 CDD:290566 6/18 (33%)
leucine-rich repeat 301..324 CDD:275380
leucine-rich repeat 325..348 CDD:275380 3/7 (43%)
LRR_RI 327..567 CDD:238064 57/234 (24%)
leucine-rich repeat 349..371 CDD:275380 5/22 (23%)
LRR_8 370..425 CDD:290566 16/59 (27%)
leucine-rich repeat 372..393 CDD:275380 7/23 (30%)
leucine-rich repeat 394..415 CDD:275380 7/22 (32%)
leucine-rich repeat 418..486 CDD:275380 10/67 (15%)
leucine-rich repeat 441..464 CDD:275378 0/22 (0%)
LRR_8 487..545 CDD:290566 16/59 (27%)
leucine-rich repeat 487..510 CDD:275380 5/22 (23%)
leucine-rich repeat 511..534 CDD:275380 7/24 (29%)
LRR_8 533..589 CDD:290566 14/55 (25%)
leucine-rich repeat 535..558 CDD:275380 6/22 (27%)
leucine-rich repeat 559..580 CDD:275380 6/20 (30%)
7tm_4 764..>892 CDD:304433
7tm_1 770..1017 CDD:278431
AgaP_AGAP005496XP_315493.3 leucine-rich repeat 108..123 CDD:275380 5/15 (33%)
LRR_RI <129..275 CDD:238064 46/167 (28%)
LRR_8 129..187 CDD:290566 20/57 (35%)
LRR_4 131..167 CDD:289563 13/35 (37%)
leucine-rich repeat 131..152 CDD:275380 9/20 (45%)
leucine-rich repeat 153..176 CDD:275380 5/22 (23%)
LRR_8 175..236 CDD:290566 19/61 (31%)
leucine-rich repeat 177..201 CDD:275380 7/24 (29%)
LRR_4 201..>236 CDD:289563 12/34 (35%)
leucine-rich repeat 202..225 CDD:275380 6/22 (27%)
leucine-rich repeat 226..250 CDD:275380 7/30 (23%)
Kinesin_assoc 329..>443 CDD:292801 11/52 (21%)
MreC 401..>468 CDD:302802
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.