DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rk and AgaP_AGAP011229

DIOPT Version :9

Sequence 1:NP_476702.1 Gene:rk / 34819 FlyBaseID:FBgn0003255 Length:1360 Species:Drosophila melanogaster
Sequence 2:XP_309414.4 Gene:AgaP_AGAP011229 / 1270695 VectorBaseID:AGAP011229 Length:398 Species:Anopheles gambiae


Alignment Length:381 Identity:113/381 - (29%)
Similarity:166/381 - (43%) Gaps:63/381 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 CHCTGSLEVLRLSCRGIGILAVPVNLPNEV-----------------------VVLDLGNNNLTK 193
            |.|.|...| |..|.|.|:..||:.|..:|                       .||||..|.:..
Mosquito    34 CTCEGDPNV-RTWCIGAGLDVVPIQLNPDVRYINLTANRITNVHFTLTFYYKLEVLDLAGNRIEA 97

  Fly   194 LEANSFFMAPNLEELTLSDNSIINMDPNAFYGLAKLKRLSLQNCG--LKSLPPQSFQGLAQLTSL 256
            |.:.:|.....|..|.||||:|:::..:||.||.:|:.|.|  ||  :.::.|.:|..|..|..|
Mosquito    98 LGSRNFDTQQALRTLNLSDNAIVSIPKDAFRGLQRLQTLKL--CGNRIDTIHPAAFHDLRNLIEL 160

  Fly   257 QLNGNALVSLDGDCLGHLQKLRTLRLEGNLFYRIP-TNALAGL-RTLEALNLGSNLLTIINDEDF 319
            .|.||||.||:...|.||..|..|..:.|....:| ...|..| :.|:.|:|..|||..|.::.|
Mosquito   161 DLEGNALTSLEPSTLRHLYSLEVLSFQNNQLLEVPYERNLEHLGQRLQLLDLSVNLLEYIANDSF 225

  Fly   320 PRMPNLIVLLLKRNQIMKISAGALKNLTALKVLELDDNLISSLPE-GLSKLSQLQELSITSNRLR 383
            ..:..|..|.|..|.:.::..||...|:.||.|::.||.::.:|. .||||..|..||::.|...
Mosquito   226 VALRELRTLRLGGNILTELDYGAFHGLSGLKALDIVDNNLTVVPTLQLSKLCNLTYLSLSGNYFE 290

  Fly   384 WINDTELPRSMQMLDMRANPLSTISPGAFRGMSKLRKLILSDVRTL-----RSFPELEACHALEI 443
                 .||..                 ||..:.:|::|.|..:..|     |:|.:..   ||.|
Mosquito   291 -----SLPAV-----------------AFLNLFQLQQLHLDRLDRLQRIDARAFVDNA---ALRI 330

  Fly   444 LKL-DRAGIQEVPANLCRQTPRLKSLELKTNSLKRIPNLSSCRD-LRLLDLSSNQI 497
            |.| |......:|..|....|.|..:.::.|:|.|:..:....| |..|:|..|.:
Mosquito   331 LTLDDNPSFASLPLRLFHSNPNLAEISMRRNALIRLDAVHFPLDRLHRLELGGNPL 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rkNP_476702.1 leucine-rich repeat 158..179 CDD:275380 8/20 (40%)
LRR_RI 180..>383 CDD:238064 74/230 (32%)
leucine-rich repeat 183..204 CDD:275380 7/20 (35%)
LRR_8 203..263 CDD:290566 24/61 (39%)
leucine-rich repeat 205..228 CDD:275380 11/22 (50%)
leucine-rich repeat 229..252 CDD:275380 8/24 (33%)
LRR_8 252..311 CDD:290566 22/60 (37%)
leucine-rich repeat 253..276 CDD:275380 12/22 (55%)
leucine-rich repeat 277..300 CDD:275380 6/24 (25%)
LRR_8 299..359 CDD:290566 20/59 (34%)
leucine-rich repeat 301..324 CDD:275380 8/22 (36%)
leucine-rich repeat 325..348 CDD:275380 7/22 (32%)
LRR_RI 327..567 CDD:238064 48/179 (27%)
leucine-rich repeat 349..371 CDD:275380 10/22 (45%)
LRR_8 370..425 CDD:290566 11/54 (20%)
leucine-rich repeat 372..393 CDD:275380 6/20 (30%)
leucine-rich repeat 394..415 CDD:275380 2/20 (10%)
leucine-rich repeat 418..486 CDD:275380 19/73 (26%)
leucine-rich repeat 441..464 CDD:275378 7/23 (30%)
LRR_8 487..545 CDD:290566 4/11 (36%)
leucine-rich repeat 487..510 CDD:275380 4/11 (36%)
leucine-rich repeat 511..534 CDD:275380
LRR_8 533..589 CDD:290566
leucine-rich repeat 535..558 CDD:275380
leucine-rich repeat 559..580 CDD:275380
7tm_4 764..>892 CDD:304433
7tm_1 770..1017 CDD:278431
AgaP_AGAP011229XP_309414.4 leucine-rich repeat 62..84 CDD:275380 1/21 (5%)
leucine-rich repeat 85..108 CDD:275380 7/22 (32%)
LRR_RI <108..289 CDD:238064 66/182 (36%)
LRR_8 109..167 CDD:290566 24/59 (41%)
leucine-rich repeat 109..132 CDD:275380 11/22 (50%)
leucine-rich repeat 133..156 CDD:275380 8/24 (33%)
LRR_8 155..239 CDD:290566 29/83 (35%)
leucine-rich repeat 157..180 CDD:275380 12/22 (55%)
leucine-rich repeat 181..206 CDD:275380 6/24 (25%)
leucine-rich repeat 207..230 CDD:275380 8/22 (36%)
LRR_8 229..289 CDD:290566 21/59 (36%)
leucine-rich repeat 231..254 CDD:275380 7/22 (32%)
leucine-rich repeat 255..278 CDD:275380 10/22 (45%)
LRR_8 278..337 CDD:290566 20/83 (24%)
leucine-rich repeat 279..302 CDD:275380 8/44 (18%)
leucine-rich repeat 303..324 CDD:275380 6/20 (30%)
leucine-rich repeat 353..366 CDD:275378 3/12 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.