DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rk and AgaP_AGAP007471

DIOPT Version :9

Sequence 1:NP_476702.1 Gene:rk / 34819 FlyBaseID:FBgn0003255 Length:1360 Species:Drosophila melanogaster
Sequence 2:XP_308401.2 Gene:AgaP_AGAP007471 / 1269752 VectorBaseID:AGAP007471 Length:406 Species:Anopheles gambiae


Alignment Length:402 Identity:89/402 - (22%)
Similarity:151/402 - (37%) Gaps:106/402 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   194 LEANSFFMAPNLEEL-------------------------------------TLSDNSIIN--MD 219
            :|.|.:::|.::|:|                                     ||::..|:|  |.
Mosquito    15 IEQNRYYLALSIEKLIVSSSASGPFLQRIATLTEQISYMAYKDPVFQLPADNTLTEIEIVNGVML 79

  Fly   220 PNAFYGLAK-LKRLSLQNCGLKSLPPQSFQGLAQLTSLQLNGNALVSLDGDCLGHLQKLRTLRLE 283
            .:...|..: |.||.::||.|..:|| :...:.:|..|.:...||.:|..|.|.:..||..:.|.
Mosquito    80 RSLVAGTNRHLTRLYVENCLLDRIPP-TLSNMIELEGLLIKQCALTALRLDVLVNNPKLTAIDLT 143

  Fly   284 GNLFYRI------PTNALAGLRTLEALNLGSNLLTIINDEDFPRMPNLIVLLLKRNQIMKISAGA 342
            .|...::      |...|    .:..|:|..|.|..::...|..||:|....::.|:|::..|.|
Mosquito   144 RNRIRQLFPITTPPKTKL----PVTFLSLAENQLDRLDMSMFAFMPDLERFNVEGNRIVRFEATA 204

  Fly   343 LKNLTALKVLELDDNLISSLPEGLSKLSQLQELSITSNRLRWINDTELPRSMQMLDMRANPLSTI 407
            .....:|..|.:..|.|:........|::|:.|.|..|.|     ||||..              
Mosquito   205 PVTYGSLIRLLVSSNNITQFDTRNLTLTELRSLYINDNAL-----TELPTH-------------- 250

  Fly   408 SPGAFRGMSKLRKLILSDVRTLRSFPELEACHALEILKLDRAGIQEVPANLCRQTPRLKSLELKT 472
                   ..||..||                    .:..||..::.:..:...:.|.|.|:.:..
Mosquito   251 -------WGKLPNLI--------------------YIGFDRNNLKRIDMSFFEKFPTLISITISE 288

  Fly   473 NSLKRIPNLS--SCRDLRLLDLSSNQIEKIQGKPFNGLKQLNDLLLSY--NRIKALPQDAFQGIP 533
            |:::.|...:  :..:|..|..:.|||..:.   |.|....|..|.|:  ||:..:| ..||..|
Mosquito   289 NNVESIRTSTPITMPELEYLMFNGNQIVSVN---FTGCNFPNMYLFSFMNNRLTTIP-PLFQRFP 349

  Fly   534 KLQLLDLEGNEI 545
            ..:|. ::||.|
Mosquito   350 DSRLA-MDGNPI 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rkNP_476702.1 leucine-rich repeat 158..179 CDD:275380
LRR_RI 180..>383 CDD:238064 53/234 (23%)
leucine-rich repeat 183..204 CDD:275380 3/9 (33%)
LRR_8 203..263 CDD:290566 18/99 (18%)
leucine-rich repeat 205..228 CDD:275380 8/61 (13%)
leucine-rich repeat 229..252 CDD:275380 8/22 (36%)
LRR_8 252..311 CDD:290566 16/64 (25%)
leucine-rich repeat 253..276 CDD:275380 7/22 (32%)
leucine-rich repeat 277..300 CDD:275380 5/28 (18%)
LRR_8 299..359 CDD:290566 15/59 (25%)
leucine-rich repeat 301..324 CDD:275380 6/22 (27%)
leucine-rich repeat 325..348 CDD:275380 5/22 (23%)
LRR_RI 327..567 CDD:238064 49/223 (22%)
leucine-rich repeat 349..371 CDD:275380 5/21 (24%)
LRR_8 370..425 CDD:290566 13/54 (24%)
leucine-rich repeat 372..393 CDD:275380 9/20 (45%)
leucine-rich repeat 394..415 CDD:275380 0/20 (0%)
leucine-rich repeat 418..486 CDD:275380 10/69 (14%)
leucine-rich repeat 441..464 CDD:275378 2/22 (9%)
LRR_8 487..545 CDD:290566 19/59 (32%)
leucine-rich repeat 487..510 CDD:275380 7/22 (32%)
leucine-rich repeat 511..534 CDD:275380 8/24 (33%)
LRR_8 533..589 CDD:290566 5/13 (38%)
leucine-rich repeat 535..558 CDD:275380 4/11 (36%)
leucine-rich repeat 559..580 CDD:275380
7tm_4 764..>892 CDD:304433
7tm_1 770..1017 CDD:278431
AgaP_AGAP007471XP_308401.2 LRR_8 88..147 CDD:290566 19/59 (32%)
leucine-rich repeat 90..112 CDD:275380 8/22 (36%)
leucine-rich repeat 113..136 CDD:275380 7/22 (32%)
LRR_8 135..197 CDD:290566 15/65 (23%)
leucine-rich repeat 137..160 CDD:275380 4/22 (18%)
leucine-rich repeat 161..186 CDD:275380 7/28 (25%)
leucine-rich repeat 187..210 CDD:275380 5/22 (23%)
leucine-rich repeat 211..233 CDD:275380 5/21 (24%)
LRR_8 232..291 CDD:290566 19/104 (18%)
leucine-rich repeat 234..256 CDD:275380 11/47 (23%)
leucine-rich repeat 257..280 CDD:275380 4/42 (10%)
leucine-rich repeat 281..304 CDD:275380 4/22 (18%)
leucine-rich repeat 305..327 CDD:275380 7/24 (29%)
leucine-rich repeat 328..350 CDD:275380 7/22 (32%)
leucine-rich repeat 351..370 CDD:275380 4/11 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.