Sequence 1: | NP_476702.1 | Gene: | rk / 34819 | FlyBaseID: | FBgn0003255 | Length: | 1360 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_308401.2 | Gene: | AgaP_AGAP007471 / 1269752 | VectorBaseID: | AGAP007471 | Length: | 406 | Species: | Anopheles gambiae |
Alignment Length: | 402 | Identity: | 89/402 - (22%) |
---|---|---|---|
Similarity: | 151/402 - (37%) | Gaps: | 106/402 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 194 LEANSFFMAPNLEEL-------------------------------------TLSDNSIIN--MD 219
Fly 220 PNAFYGLAK-LKRLSLQNCGLKSLPPQSFQGLAQLTSLQLNGNALVSLDGDCLGHLQKLRTLRLE 283
Fly 284 GNLFYRI------PTNALAGLRTLEALNLGSNLLTIINDEDFPRMPNLIVLLLKRNQIMKISAGA 342
Fly 343 LKNLTALKVLELDDNLISSLPEGLSKLSQLQELSITSNRLRWINDTELPRSMQMLDMRANPLSTI 407
Fly 408 SPGAFRGMSKLRKLILSDVRTLRSFPELEACHALEILKLDRAGIQEVPANLCRQTPRLKSLELKT 472
Fly 473 NSLKRIPNLS--SCRDLRLLDLSSNQIEKIQGKPFNGLKQLNDLLLSY--NRIKALPQDAFQGIP 533
Fly 534 KLQLLDLEGNEI 545 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
rk | NP_476702.1 | leucine-rich repeat | 158..179 | CDD:275380 | |
LRR_RI | 180..>383 | CDD:238064 | 53/234 (23%) | ||
leucine-rich repeat | 183..204 | CDD:275380 | 3/9 (33%) | ||
LRR_8 | 203..263 | CDD:290566 | 18/99 (18%) | ||
leucine-rich repeat | 205..228 | CDD:275380 | 8/61 (13%) | ||
leucine-rich repeat | 229..252 | CDD:275380 | 8/22 (36%) | ||
LRR_8 | 252..311 | CDD:290566 | 16/64 (25%) | ||
leucine-rich repeat | 253..276 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 277..300 | CDD:275380 | 5/28 (18%) | ||
LRR_8 | 299..359 | CDD:290566 | 15/59 (25%) | ||
leucine-rich repeat | 301..324 | CDD:275380 | 6/22 (27%) | ||
leucine-rich repeat | 325..348 | CDD:275380 | 5/22 (23%) | ||
LRR_RI | 327..567 | CDD:238064 | 49/223 (22%) | ||
leucine-rich repeat | 349..371 | CDD:275380 | 5/21 (24%) | ||
LRR_8 | 370..425 | CDD:290566 | 13/54 (24%) | ||
leucine-rich repeat | 372..393 | CDD:275380 | 9/20 (45%) | ||
leucine-rich repeat | 394..415 | CDD:275380 | 0/20 (0%) | ||
leucine-rich repeat | 418..486 | CDD:275380 | 10/69 (14%) | ||
leucine-rich repeat | 441..464 | CDD:275378 | 2/22 (9%) | ||
LRR_8 | 487..545 | CDD:290566 | 19/59 (32%) | ||
leucine-rich repeat | 487..510 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 511..534 | CDD:275380 | 8/24 (33%) | ||
LRR_8 | 533..589 | CDD:290566 | 5/13 (38%) | ||
leucine-rich repeat | 535..558 | CDD:275380 | 4/11 (36%) | ||
leucine-rich repeat | 559..580 | CDD:275380 | |||
7tm_4 | 764..>892 | CDD:304433 | |||
7tm_1 | 770..1017 | CDD:278431 | |||
AgaP_AGAP007471 | XP_308401.2 | LRR_8 | 88..147 | CDD:290566 | 19/59 (32%) |
leucine-rich repeat | 90..112 | CDD:275380 | 8/22 (36%) | ||
leucine-rich repeat | 113..136 | CDD:275380 | 7/22 (32%) | ||
LRR_8 | 135..197 | CDD:290566 | 15/65 (23%) | ||
leucine-rich repeat | 137..160 | CDD:275380 | 4/22 (18%) | ||
leucine-rich repeat | 161..186 | CDD:275380 | 7/28 (25%) | ||
leucine-rich repeat | 187..210 | CDD:275380 | 5/22 (23%) | ||
leucine-rich repeat | 211..233 | CDD:275380 | 5/21 (24%) | ||
LRR_8 | 232..291 | CDD:290566 | 19/104 (18%) | ||
leucine-rich repeat | 234..256 | CDD:275380 | 11/47 (23%) | ||
leucine-rich repeat | 257..280 | CDD:275380 | 4/42 (10%) | ||
leucine-rich repeat | 281..304 | CDD:275380 | 4/22 (18%) | ||
leucine-rich repeat | 305..327 | CDD:275380 | 7/24 (29%) | ||
leucine-rich repeat | 328..350 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 351..370 | CDD:275380 | 4/11 (36%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |