DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rk and AgaP_AGAP013278

DIOPT Version :9

Sequence 1:NP_476702.1 Gene:rk / 34819 FlyBaseID:FBgn0003255 Length:1360 Species:Drosophila melanogaster
Sequence 2:XP_003436849.1 Gene:AgaP_AGAP013278 / 11176038 VectorBaseID:AGAP013278 Length:260 Species:Anopheles gambiae


Alignment Length:306 Identity:70/306 - (22%)
Similarity:118/306 - (38%) Gaps:77/306 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   335 IMKISAGALKNLT-----ALKVLELDDNLISSLPEGLSKLSQLQELSITSNRLRWINDTE----- 389
            :.|:.| .::.||     |:|.|.:..||.:|            |:.||...:..|:..|     
Mosquito     9 LYKVPA-TVQTLTIISSPAMKHLHIPSNLSAS------------EMYITRTGINSIHFEENISLN 60

  Fly   390 ----LPRSMQMLDMRANPLSTISPGAFR-GMSKLRKLILSDVRTLRSFPELEACHALEILKLDRA 449
                .|..::.|......|..::  .|| ..|:::.|.:..:|..::         :|.|.:.|:
Mosquito    61 TVIISPCELEQLPFTLGNLKKLA--FFRISNSQIQVLYIQQLRLAKN---------VERLMVVRS 114

  Fly   450 GIQEV----PANLCRQTPRLKSLELKTNSLKRI--PNLSSCRDLRLLDLSSNQIEKIQGKPFNGL 508
            .|..:    |...|   .||..|:|:.|.|..|  ........||:|.|:.|.||.:.|.|.|  
Mosquito   115 RIHSIIIDSPERCC---DRLDELDLQKNLLTSIDFATFDPLHRLRVLILADNSIEMLVGSPSN-- 174

  Fly   509 KQLNDLLLSYNRIKALPQDAFQGIPKLQLLDLEGNEISYIHKEAFSGFTALEDLNLGNNIFPELP 573
            ..|..|:|:.|.||.:....:..:|.|..::|:.|.::   ||.    :.||:|:....::..|.
Mosquito   175 SALEYLVLTNNHIKHIAFCGWNPLPSLISVNLKNNRLA---KEP----SCLENLSTNATVYVTLY 232

  Fly   574 ESGLRALLHLKTFNNPKLREFPPPDTFPRIQTLILSYAYHCCAFLP 619
            ...:...:.||..:..|||                    .|..|.|
Mosquito   233 GRTMEKFVELKNRSQSKLR--------------------FCLTFFP 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rkNP_476702.1 leucine-rich repeat 158..179 CDD:275380
LRR_RI 180..>383 CDD:238064 13/52 (25%)
leucine-rich repeat 183..204 CDD:275380
LRR_8 203..263 CDD:290566
leucine-rich repeat 205..228 CDD:275380
leucine-rich repeat 229..252 CDD:275380
LRR_8 252..311 CDD:290566
leucine-rich repeat 253..276 CDD:275380
leucine-rich repeat 277..300 CDD:275380
LRR_8 299..359 CDD:290566 8/28 (29%)
leucine-rich repeat 301..324 CDD:275380
leucine-rich repeat 325..348 CDD:275380 4/17 (24%)
LRR_RI 327..567 CDD:238064 61/252 (24%)
leucine-rich repeat 349..371 CDD:275380 5/21 (24%)
LRR_8 370..425 CDD:290566 12/64 (19%)
leucine-rich repeat 372..393 CDD:275380 6/29 (21%)
leucine-rich repeat 394..415 CDD:275380 4/21 (19%)
leucine-rich repeat 418..486 CDD:275380 15/73 (21%)
leucine-rich repeat 441..464 CDD:275378 6/26 (23%)
LRR_8 487..545 CDD:290566 20/57 (35%)
leucine-rich repeat 487..510 CDD:275380 10/22 (45%)
leucine-rich repeat 511..534 CDD:275380 6/22 (27%)
LRR_8 533..589 CDD:290566 12/55 (22%)
leucine-rich repeat 535..558 CDD:275380 5/22 (23%)
leucine-rich repeat 559..580 CDD:275380 4/20 (20%)
7tm_4 764..>892 CDD:304433
7tm_1 770..1017 CDD:278431
AgaP_AGAP013278XP_003436849.1 leucine-rich repeat 36..58 CDD:275380 7/33 (21%)
leucine-rich repeat 79..105 CDD:275380 6/27 (22%)
LRR_RI <88..>227 CDD:238064 41/159 (26%)
leucine-rich repeat 106..130 CDD:275380 6/26 (23%)
LRR_8 130..187 CDD:290566 21/58 (36%)
leucine-rich repeat 131..154 CDD:275380 6/22 (27%)
leucine-rich repeat 155..176 CDD:275380 10/22 (45%)
leucine-rich repeat 177..200 CDD:275380 6/22 (27%)
leucine-rich repeat 201..221 CDD:275380 7/26 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.