Sequence 1: | NP_476702.1 | Gene: | rk / 34819 | FlyBaseID: | FBgn0003255 | Length: | 1360 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_003436644.1 | Gene: | AgaP_AGAP013059 / 11175769 | VectorBaseID: | AGAP013059 | Length: | 517 | Species: | Anopheles gambiae |
Alignment Length: | 351 | Identity: | 95/351 - (27%) |
---|---|---|---|
Similarity: | 153/351 - (43%) | Gaps: | 46/351 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 253 LTSLQLNGNALVSLDGDCLGHLQKLRTLRLEGNLFYR-IPTNALAGLRTLEALNLGSNLLTIIND 316
Fly 317 EDFPRMPNLIVLLLKRNQIMKISAGALKNLTALKVLELDDNLISSLPEGL-SKLSQLQELSITSN 380
Fly 381 RLRWIN-DTELPR----SMQMLDMRANPLSTISPGAFRGMSKLRKL-----ILSDVRTLRSFPEL 435
Fly 436 EACH-ALEILKLDRAGIQEVPANLCRQTPRLKSLELKTNSLKRIPNLSSCRD-LRLLDLSSNQIE 498
Fly 499 KIQGKPFNGLKQLNDLLLSYNRIKALPQDAFQGIPKLQLLDLEGNEISYIHKEAFSGFTALEDLN 563
Fly 564 L-GNNI-----------FPELPESGL 577 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
rk | NP_476702.1 | leucine-rich repeat | 158..179 | CDD:275380 | |
LRR_RI | 180..>383 | CDD:238064 | 36/131 (27%) | ||
leucine-rich repeat | 183..204 | CDD:275380 | |||
LRR_8 | 203..263 | CDD:290566 | 2/9 (22%) | ||
leucine-rich repeat | 205..228 | CDD:275380 | |||
leucine-rich repeat | 229..252 | CDD:275380 | |||
LRR_8 | 252..311 | CDD:290566 | 11/58 (19%) | ||
leucine-rich repeat | 253..276 | CDD:275380 | 3/22 (14%) | ||
leucine-rich repeat | 277..300 | CDD:275380 | 7/23 (30%) | ||
LRR_8 | 299..359 | CDD:290566 | 17/59 (29%) | ||
leucine-rich repeat | 301..324 | CDD:275380 | 4/22 (18%) | ||
leucine-rich repeat | 325..348 | CDD:275380 | 8/22 (36%) | ||
LRR_RI | 327..567 | CDD:238064 | 73/253 (29%) | ||
leucine-rich repeat | 349..371 | CDD:275380 | 9/22 (41%) | ||
LRR_8 | 370..425 | CDD:290566 | 16/64 (25%) | ||
leucine-rich repeat | 372..393 | CDD:275380 | 7/25 (28%) | ||
leucine-rich repeat | 394..415 | CDD:275380 | 5/20 (25%) | ||
leucine-rich repeat | 418..486 | CDD:275380 | 17/73 (23%) | ||
leucine-rich repeat | 441..464 | CDD:275378 | 2/22 (9%) | ||
LRR_8 | 487..545 | CDD:290566 | 20/57 (35%) | ||
leucine-rich repeat | 487..510 | CDD:275380 | 10/22 (45%) | ||
leucine-rich repeat | 511..534 | CDD:275380 | 3/22 (14%) | ||
LRR_8 | 533..589 | CDD:290566 | 17/57 (30%) | ||
leucine-rich repeat | 535..558 | CDD:275380 | 6/22 (27%) | ||
leucine-rich repeat | 559..580 | CDD:275380 | 10/31 (32%) | ||
7tm_4 | 764..>892 | CDD:304433 | |||
7tm_1 | 770..1017 | CDD:278431 | |||
AgaP_AGAP013059 | XP_003436644.1 | leucine-rich repeat | 62..85 | CDD:275380 | 3/22 (14%) |
LRR_8 | 84..145 | CDD:290566 | 16/60 (27%) | ||
leucine-rich repeat | 86..110 | CDD:275380 | 7/23 (30%) | ||
leucine-rich repeat | 111..134 | CDD:275380 | 4/22 (18%) | ||
LRR_8 | 133..193 | CDD:290566 | 21/59 (36%) | ||
leucine-rich repeat | 135..158 | CDD:275380 | 8/22 (36%) | ||
LRR_RI | 158..398 | CDD:238064 | 72/255 (28%) | ||
leucine-rich repeat | 159..182 | CDD:275380 | 9/22 (41%) | ||
leucine-rich repeat | 183..209 | CDD:275380 | 7/25 (28%) | ||
leucine-rich repeat | 230..269 | CDD:275380 | 10/51 (20%) | ||
LRR_8 | 269..348 | CDD:290566 | 28/81 (35%) | ||
leucine-rich repeat | 270..288 | CDD:275380 | 6/17 (35%) | ||
leucine-rich repeat | 293..337 | CDD:275380 | 15/46 (33%) | ||
LRR | <309..>401 | CDD:227223 | 24/85 (28%) | ||
leucine-rich repeat | 338..358 | CDD:275380 | 6/19 (32%) | ||
leucine-rich repeat | 362..382 | CDD:275380 | 6/19 (32%) | ||
leucine-rich repeat | 387..399 | CDD:275378 | 2/6 (33%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |