DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rk and AT2G30105

DIOPT Version :9

Sequence 1:NP_476702.1 Gene:rk / 34819 FlyBaseID:FBgn0003255 Length:1360 Species:Drosophila melanogaster
Sequence 2:NP_001189636.2 Gene:AT2G30105 / 10723124 AraportID:AT2G30105 Length:374 Species:Arabidopsis thaliana


Alignment Length:398 Identity:91/398 - (22%)
Similarity:163/398 - (40%) Gaps:95/398 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 LEELTLSDNSIINMDPNAFYGLAKL------KRLSLQ---NCGLKSLPPQSFQGLAQLTSLQLNG 260
            ||:.|::|::|            ||      |.:.|.   :|.:|.|..|    |..:|::...|
plant     3 LEDPTMADSTI------------KLTVKFGGKSIPLSVSPDCTVKDLKSQ----LQPITNVLPRG 51

  Fly   261 NALV----------SLDGDCLGHLQKLRTLRLEGNLFYRIPTNALAGLRTLEALNLGSNLLTIIN 315
            ..|:          :|....:|...||..:..:|......|....|.:|.:..        |:::
plant    52 QKLIFKGKVLVETSTLKQSDVGSGAKLMLMASQGLHQGEGPILKEASIRPISR--------TVVS 108

  Fly   316 DEDFPRMPNLIVLLLKRNQ--------IMKISAGALKNL--------TALKVLELDDNLISSLPE 364
            |:...|.|:::|   .:|:        ::.::...||.:        :.::||::.:|.|..:|.
plant   109 DKVDQRKPSVLV---DKNRTDRWKATGVIALAQANLKEIPEEVWDCGSGVRVLDISENFIKEVPA 170

  Fly   365 GLSKLSQLQELSITSNRL-----RWINDTELPRSMQMLDMRANPLSTISPGAFRGMSKLRKLILS 424
            .:|....:|:|.:..|.|     :|.....|.|.| :|.:..|.| |:.|.|...::.||:|.::
plant   171 KISSFGSMQKLFLQGNGLSDESIQWEGIASLKRLM-LLSISHNNL-TVLPSAMGSLTSLRQLDVT 233

  Fly   425 DVRTLRSFP-ELEACHALEILKLDRAGIQEVPANLCRQTPRLKSLELKTNSLKRIPNLSSCRDLR 488
            : ..|.|.| ||.....|||||.:...|..:|                       .::.:|..|.
plant   234 N-NKLTSLPNELGLLTQLEILKANNNRITSLP-----------------------ESIGNCSFLM 274

  Fly   489 LLDLSSNQIEKIQGKPFNGLKQLNDLLLSYNRIKALPQDAFQGIPKLQLLDLEGNEISYIHKEAF 553
            .:|||:|.|.::. :.|..|:.|..|.|:...:|.||...|:...:|..|.|...||:......|
plant   275 EVDLSANIISELP-ETFTKLRNLKTLELNNTGLKTLPSALFKMCLQLSTLGLHNTEITVEFLRQF 338

  Fly   554 SGFTALED 561
            .|:...::
plant   339 EGYDDFDE 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rkNP_476702.1 leucine-rich repeat 158..179 CDD:275380
LRR_RI 180..>383 CDD:238064 43/217 (20%)
leucine-rich repeat 183..204 CDD:275380
LRR_8 203..263 CDD:290566 16/66 (24%)
leucine-rich repeat 205..228 CDD:275380 5/22 (23%)
leucine-rich repeat 229..252 CDD:275380 8/31 (26%)
LRR_8 252..311 CDD:290566 11/68 (16%)
leucine-rich repeat 253..276 CDD:275380 5/32 (16%)
leucine-rich repeat 277..300 CDD:275380 4/22 (18%)
LRR_8 299..359 CDD:290566 12/75 (16%)
leucine-rich repeat 301..324 CDD:275380 3/22 (14%)
leucine-rich repeat 325..348 CDD:275380 4/38 (11%)
LRR_RI 327..567 CDD:238064 62/257 (24%)
leucine-rich repeat 349..371 CDD:275380 6/21 (29%)
LRR_8 370..425 CDD:290566 17/59 (29%)
leucine-rich repeat 372..393 CDD:275380 6/25 (24%)
leucine-rich repeat 394..415 CDD:275380 7/20 (35%)
leucine-rich repeat 418..486 CDD:275380 16/68 (24%)
leucine-rich repeat 441..464 CDD:275378 7/22 (32%)
LRR_8 487..545 CDD:290566 18/57 (32%)
leucine-rich repeat 487..510 CDD:275380 8/22 (36%)
leucine-rich repeat 511..534 CDD:275380 7/22 (32%)
LRR_8 533..589 CDD:290566 7/29 (24%)
leucine-rich repeat 535..558 CDD:275380 7/22 (32%)
leucine-rich repeat 559..580 CDD:275380 0/3 (0%)
7tm_4 764..>892 CDD:304433
7tm_1 770..1017 CDD:278431
AT2G30105NP_001189636.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.