Sequence 1: | NP_476702.1 | Gene: | rk / 34819 | FlyBaseID: | FBgn0003255 | Length: | 1360 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001026862.1 | Gene: | LRRC17 / 10234 | HGNCID: | 16895 | Length: | 441 | Species: | Homo sapiens |
Alignment Length: | 328 | Identity: | 83/328 - (25%) |
---|---|---|---|
Similarity: | 127/328 - (38%) | Gaps: | 82/328 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 276 KLRTLRLEGNLFYRIPTNALAGLRTLEALNLGSNLLTIINDEDFPRMPNLIVLLLKRNQIMKISA 340
Fly 341 GALKNLTALKVLELDDNLISSLPEGLSKLSQLQELSITSNRLRWINDTELPRSMQMLDMRANPLS 405
Fly 406 TISPGAFRGMSKLRKLILSDVRTLRSFPELEACHALEILKLD-------RAGI--QEVPANLCRQ 461
Fly 462 --TPRLKSLELKTNSLKRIPNLSSCRDLRLLDLSSNQIEKIQGKPFNGLKQLNDLLLSYNRIKAL 524
Fly 525 PQDAFQGIPKLQLLDLEGNEISYIHKEAFSGFTALEDLNLGNNIFPELPESGLRALLHLKTF--- 586
Fly 587 NNP 589 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
rk | NP_476702.1 | leucine-rich repeat | 158..179 | CDD:275380 | |
LRR_RI | 180..>383 | CDD:238064 | 29/106 (27%) | ||
leucine-rich repeat | 183..204 | CDD:275380 | |||
LRR_8 | 203..263 | CDD:290566 | |||
leucine-rich repeat | 205..228 | CDD:275380 | |||
leucine-rich repeat | 229..252 | CDD:275380 | |||
LRR_8 | 252..311 | CDD:290566 | 10/34 (29%) | ||
leucine-rich repeat | 253..276 | CDD:275380 | 83/328 (25%) | ||
leucine-rich repeat | 277..300 | CDD:275380 | 5/22 (23%) | ||
LRR_8 | 299..359 | CDD:290566 | 19/59 (32%) | ||
leucine-rich repeat | 301..324 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 325..348 | CDD:275380 | 7/22 (32%) | ||
LRR_RI | 327..567 | CDD:238064 | 61/250 (24%) | ||
leucine-rich repeat | 349..371 | CDD:275380 | 6/21 (29%) | ||
LRR_8 | 370..425 | CDD:290566 | 8/54 (15%) | ||
leucine-rich repeat | 372..393 | CDD:275380 | 3/20 (15%) | ||
leucine-rich repeat | 394..415 | CDD:275380 | 3/20 (15%) | ||
leucine-rich repeat | 418..486 | CDD:275380 | 17/78 (22%) | ||
leucine-rich repeat | 441..464 | CDD:275378 | 7/33 (21%) | ||
LRR_8 | 487..545 | CDD:290566 | 13/57 (23%) | ||
leucine-rich repeat | 487..510 | CDD:275380 | 2/22 (9%) | ||
leucine-rich repeat | 511..534 | CDD:275380 | 7/22 (32%) | ||
LRR_8 | 533..589 | CDD:290566 | 20/58 (34%) | ||
leucine-rich repeat | 535..558 | CDD:275380 | 9/22 (41%) | ||
leucine-rich repeat | 559..580 | CDD:275380 | 7/20 (35%) | ||
7tm_4 | 764..>892 | CDD:304433 | |||
7tm_1 | 770..1017 | CDD:278431 | |||
LRRC17 | NP_001026862.1 | leucine-rich repeat | 63..81 | CDD:275380 | |
LRR 1 | 82..103 | 6/12 (50%) | |||
LRR_8 | 84..141 | CDD:290566 | 18/58 (31%) | ||
leucine-rich repeat | 84..106 | CDD:275380 | 6/23 (26%) | ||
LRR_4 | 105..146 | CDD:289563 | 14/40 (35%) | ||
LRR 2 | 106..127 | 7/20 (35%) | |||
leucine-rich repeat | 107..130 | CDD:275380 | 7/22 (32%) | ||
LRR 3 | 130..151 | 7/20 (35%) | |||
leucine-rich repeat | 131..154 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 155..244 | CDD:275380 | 24/120 (20%) | ||
leucine-rich repeat | 249..269 | CDD:275380 | 6/20 (30%) | ||
LRR_RI | <267..>351 | CDD:238064 | 30/107 (28%) | ||
LRR 4 | 269..290 | 10/44 (23%) | |||
leucine-rich repeat | 270..293 | CDD:275380 | 9/46 (20%) | ||
LRR_8 | 272..328 | CDD:290566 | 25/79 (32%) | ||
LRR 5 | 293..314 | 8/20 (40%) | |||
LRR_4 | 294..332 | CDD:289563 | 16/37 (43%) | ||
leucine-rich repeat | 294..317 | CDD:275380 | 9/22 (41%) | ||
LRR 6 | 317..340 | 7/22 (32%) | |||
leucine-rich repeat | 318..341 | CDD:275380 | 8/22 (36%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |