DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rk and tril

DIOPT Version :9

Sequence 1:NP_476702.1 Gene:rk / 34819 FlyBaseID:FBgn0003255 Length:1360 Species:Drosophila melanogaster
Sequence 2:XP_002933436.2 Gene:tril / 100498304 XenbaseID:XB-GENE-6050227 Length:872 Species:Xenopus tropicalis


Alignment Length:442 Identity:114/442 - (25%)
Similarity:167/442 - (37%) Gaps:125/442 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 CHCTGSLEVLRLSCRGIGILAVPVNLPNEVVVLDLGNNNLTKLEANSFFMAPNLEELTLSDNSII 216
            |.|.....||   |...|:|:||            .::::....|...|        :|..|.|.
 Frog    29 CDCQHQQHVL---CSNRGLLSVP------------KSSHMLSSSATKTF--------SLGGNFIA 70

  Fly   217 NMDPNAFYGLAKLKRLSLQNCGLKSLPPQSFQGLAQLTSLQLNGNALVSLDGDCLGHLQKLRTLR 281
            |:....|....:|:||.||...:.|:.|::|:.|.:|..|.|..|.|.:|....|..|:||:.|.
 Frog    71 NISALDFVQFPQLQRLDLQYNRIGSIHPKAFEKLTELEELYLGNNLLATLAPGALAPLRKLKVLN 135

  Fly   282 LEGNLFYRIPTNALAGLRTLEALNLGSNLLTIINDEDFPRMPNLIVLLLKRNQIMKISAGALKNL 346
            :.||..:.|...:.:.|..|..|.|..|.:..:....|..:.||:.|.|:.|:|..||..|...|
 Frog   136 VNGNRLHNISRVSFSNLAALIKLRLDGNDIQNLQGSPFSALSNLLYLHLENNKITNISKNAFTGL 200

  Fly   347 TALKVLELDDNLISSLPEGLSKLSQLQELSITSNRLRWINDTELP-RSMQMLDMRANPLSTISPG 410
            ..|::|.|..|..|.|.:                      .|.|| |::..|.|..|.|..:.|.
 Frog   201 GKLRLLSLSGNPQSFLRQ----------------------PTFLPLRALSTLTMAGNQLQQLGPS 243

  Fly   411 AFRGMSKLRKLILSDVRTLRSFPELEACHALEILKLDRAGIQEVPANLCRQTPRLKSLELKTNSL 475
            .|.|:.:|.:|:                                                     
 Frog   244 LFNGLQRLSRLV----------------------------------------------------- 255

  Fly   476 KRIPNLSSCRDLRLLDLSSNQIEKIQGKPFNGLKQLNDLLLSYNRIKALPQDAFQGIPKLQLLDL 540
                            ||||||..||.|.|.||..|.:|.|..|::..||:.....:..|::|:|
 Frog   256 ----------------LSSNQISVIQTKTFLGLDLLQELHLDGNKLVQLPEGVLVPLHNLEVLNL 304

  Fly   541 EGNEISYIHKEAFSGFTALEDLNLGNNIFPELPESGLRALLHLKTF-NNPKL 591
            ..|.||::|.|.|.|...|..|:|.:|:...|  ||       :|| .||.|
 Frog   305 SRNAISHLHPETFKGLMRLRVLDLQHNMLRYL--SG-------QTFAGNPVL 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rkNP_476702.1 leucine-rich repeat 158..179 CDD:275380 7/20 (35%)
LRR_RI 180..>383 CDD:238064 52/202 (26%)
leucine-rich repeat 183..204 CDD:275380 2/20 (10%)
LRR_8 203..263 CDD:290566 18/59 (31%)
leucine-rich repeat 205..228 CDD:275380 5/22 (23%)
leucine-rich repeat 229..252 CDD:275380 9/22 (41%)
LRR_8 252..311 CDD:290566 19/58 (33%)
leucine-rich repeat 253..276 CDD:275380 8/22 (36%)
leucine-rich repeat 277..300 CDD:275380 6/22 (27%)
LRR_8 299..359 CDD:290566 19/59 (32%)
leucine-rich repeat 301..324 CDD:275380 5/22 (23%)
leucine-rich repeat 325..348 CDD:275380 9/22 (41%)
LRR_RI 327..567 CDD:238064 58/240 (24%)
leucine-rich repeat 349..371 CDD:275380 6/21 (29%)
LRR_8 370..425 CDD:290566 13/55 (24%)
leucine-rich repeat 372..393 CDD:275380 3/21 (14%)
leucine-rich repeat 394..415 CDD:275380 6/20 (30%)
leucine-rich repeat 418..486 CDD:275380 2/67 (3%)
leucine-rich repeat 441..464 CDD:275378 0/22 (0%)
LRR_8 487..545 CDD:290566 22/57 (39%)
leucine-rich repeat 487..510 CDD:275380 12/22 (55%)
leucine-rich repeat 511..534 CDD:275380 6/22 (27%)
LRR_8 533..589 CDD:290566 19/56 (34%)
leucine-rich repeat 535..558 CDD:275380 10/22 (45%)
leucine-rich repeat 559..580 CDD:275380 7/20 (35%)
7tm_4 764..>892 CDD:304433
7tm_1 770..1017 CDD:278431
trilXP_002933436.2 leucine-rich repeat 35..58 CDD:275378 7/37 (19%)
leucine-rich repeat 59..82 CDD:275380 6/30 (20%)
leucine-rich repeat 83..106 CDD:275380 9/22 (41%)
internalin_A 84..>375 CDD:380193 97/364 (27%)
leucine-rich repeat 107..130 CDD:275380 8/22 (36%)
leucine-rich repeat 131..154 CDD:275380 6/22 (27%)
leucine-rich repeat 155..178 CDD:275380 5/22 (23%)
leucine-rich repeat 179..202 CDD:275380 9/22 (41%)
leucine-rich repeat 203..226 CDD:275380 9/44 (20%)
leucine-rich repeat 227..250 CDD:275380 7/22 (32%)
leucine-rich repeat 251..274 CDD:275380 14/91 (15%)
leucine-rich repeat 275..298 CDD:275380 6/22 (27%)
leucine-rich repeat 299..320 CDD:275380 9/20 (45%)
leucine-rich repeat 323..346 CDD:275380 10/31 (32%)
fn3 662..737 CDD:394996
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.