DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rk and XB964897

DIOPT Version :9

Sequence 1:NP_476702.1 Gene:rk / 34819 FlyBaseID:FBgn0003255 Length:1360 Species:Drosophila melanogaster
Sequence 2:NP_001123809.1 Gene:XB964897 / 100170560 XenbaseID:XB-GENE-964898 Length:798 Species:Xenopus tropicalis


Alignment Length:480 Identity:127/480 - (26%)
Similarity:203/480 - (42%) Gaps:131/480 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 ETKENPAPDMQNS--------QEQEPY------VHLQH-----LQQQQQQNPQTVQQLS------ 75
            ||..|..||::|.        .:.:|.      |.|..     |:|....|..||::|.      
 Frog   349 ETGINDIPDVKNDLAFLFHMIDQYDPLYSKRFAVFLSEASENKLKQLNLNNEWTVEKLRLKLQTN 413

  Fly    76 --------------------QITVNRTSKSASVTPTGIRENVMLPSADPEKEAQI--LYEKSL-- 116
                                :||..::.|..|:      .|||:|:|    .||:  |.|.||  
 Frog   414 ASNRLELHLLKLPGLPDTVFEITELQSLKLESI------PNVMIPAA----IAQLNNLQELSLWT 468

  Fly   117 --QEYHGSQLSTASTATDVIAGKRTLHSICERWL------QKHCHCTGSLEVLRLSCRGIGILAV 173
              .:.|.:.|:..         |..:||:..:::      |..|. .||||.|.|:  |:....:
 Frog   469 CPAKIHSAALAFL---------KENVHSLSVKFVGSPHIPQWMCD-LGSLEELNLT--GLFTPEI 521

  Fly   174 PVNLPN----------EVVVLDLGNNNLTKLEANSFFMAPNLEELTLSDNSIINMDPNAFYGLAK 228
            ..:.||          .:|:    |:|||.:...:..::..|::|::.:|.|..:..|:...:|.
 Frog   522 SKHFPNYSFKKLKSLKHLVI----NSNLTSIPQYAVDISAQLQKLSIDNNEIKLVTRNSLKNMAN 582

  Fly   229 LKRLSLQNCGLKSLPPQSFQGLAQLTSLQLNGNALVSL-DGDCLGHLQKLRTLRLEGNLFYRIPT 292
            |..|.|.||.|..:|...|..|| |..|.|..|.|.|: :.....:||||..|:|..|...:||.
 Frog   583 LMTLELVNCKLDQIPNSIFSLLA-LKELDLKNNNLKSIQEIASFQNLQKLSILKLWHNSITKIPD 646

  Fly   293 NALAGLRTLEALNLGSNLLTIINDEDFPRMPNLIVLLLKRNQIMKISAGALKNLTALKVLELDDN 357
            : ::.|..||.|.:..|     |..|   :|:.:.|..|                 |:.|||.:|
 Frog   647 H-ISKLANLEQLYISHN-----NIGD---LPHDLFLCCK-----------------LRHLELSNN 685

  Fly   358 LISSLPEGLSKLSQLQELSITSNRLRWINDTEL--PRSMQMLDMRANPLSTISPGAFRGMSKLRK 420
            .|.|:|..:..||.|:..|::.||:..|.| ||  .:.::.|::|.|.::|:||    .:..|.:
 Frog   686 NIRSIPHIIRNLSNLKYFSVSYNRIETIPD-ELYFCQKLETLNLRHNNINTLSP----NIGNLAQ 745

  Fly   421 LILSDVR--TLRSFP-ELEACHALE 442
            |...||:  .:.|.| ||.:|.||:
 Frog   746 LSCLDVKENPIGSLPLELGSCQALK 770

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rkNP_476702.1 leucine-rich repeat 158..179 CDD:275380 5/20 (25%)
LRR_RI 180..>383 CDD:238064 60/203 (30%)
leucine-rich repeat 183..204 CDD:275380 4/20 (20%)
LRR_8 203..263 CDD:290566 20/59 (34%)
leucine-rich repeat 205..228 CDD:275380 5/22 (23%)
leucine-rich repeat 229..252 CDD:275380 9/22 (41%)
LRR_8 252..311 CDD:290566 20/59 (34%)
leucine-rich repeat 253..276 CDD:275380 7/23 (30%)
leucine-rich repeat 277..300 CDD:275380 7/22 (32%)
LRR_8 299..359 CDD:290566 14/59 (24%)
leucine-rich repeat 301..324 CDD:275380 6/22 (27%)
leucine-rich repeat 325..348 CDD:275380 2/22 (9%)
LRR_RI 327..567 CDD:238064 37/121 (31%)
leucine-rich repeat 349..371 CDD:275380 9/21 (43%)
LRR_8 370..425 CDD:290566 17/56 (30%)
leucine-rich repeat 372..393 CDD:275380 8/22 (36%)
leucine-rich repeat 394..415 CDD:275380 6/20 (30%)
leucine-rich repeat 418..486 CDD:275380 11/28 (39%)
leucine-rich repeat 441..464 CDD:275378 1/2 (50%)
LRR_8 487..545 CDD:290566
leucine-rich repeat 487..510 CDD:275380
leucine-rich repeat 511..534 CDD:275380
LRR_8 533..589 CDD:290566
leucine-rich repeat 535..558 CDD:275380
leucine-rich repeat 559..580 CDD:275380
7tm_4 764..>892 CDD:304433
7tm_1 770..1017 CDD:278431
XB964897NP_001123809.1 leucine-rich repeat 606..630 CDD:275380 7/23 (30%)
leucine-rich repeat 631..653 CDD:275380 7/22 (32%)
leucine-rich repeat 654..676 CDD:275380 8/29 (28%)
LRR_8 676..733 CDD:290566 22/74 (30%)
leucine-rich repeat 677..699 CDD:275380 9/21 (43%)
leucine-rich repeat 700..722 CDD:275380 8/22 (36%)
leucine-rich repeat 723..745 CDD:275380 7/25 (28%)
leucine-rich repeat 746..766 CDD:275380 7/19 (37%)
Pannexin_like 1..330 CDD:289311
leucine-rich repeat 392..437 CDD:275380 7/44 (16%)
leucine-rich repeat 488..504 CDD:275380 1/15 (7%)
LRR_RI 534..767 CDD:238064 78/268 (29%)
leucine-rich repeat 536..558 CDD:275380 5/25 (20%)
LRR_8 558..616 CDD:290566 20/58 (34%)
leucine-rich repeat 559..582 CDD:275380 5/22 (23%)
leucine-rich repeat 583..605 CDD:275380 8/21 (38%)
LRR_8 606..664 CDD:290566 20/63 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.