DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimC2 and SCARF1

DIOPT Version :9

Sequence 1:NP_001285922.1 Gene:NimC2 / 34818 FlyBaseID:FBgn0028939 Length:701 Species:Drosophila melanogaster
Sequence 2:NP_003684.2 Gene:SCARF1 / 8578 HGNCID:16820 Length:830 Species:Homo sapiens


Alignment Length:572 Identity:147/572 - (25%)
Similarity:179/572 - (31%) Gaps:221/572 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 CCDGYIRDENNEC-VPLC---NDCGASGKCLLPNVCLCGKGYVSRKDHGHCE---------PECS 116
            ||.|: |.::.|| :|:|   :.|.....|:.|.:|.|..|:..    .||.         |:|.
Human    41 CCAGW-RQKDQECTIPICEGPDACQKDEVCVKPGLCRCKPGFFG----AHCSSRCPGQYWGPDCR 100

  Fly   117 ESCVNGKCVAPDECECLAGHRFVNGSQTACEPICVEDCANGRC-LETGKCLCNNGYQRDEKLKKC 180
            |||                         .|.|       :|:| ..||.|.|    |.|....:|
Human   101 ESC-------------------------PCHP-------HGQCEPATGACQC----QADRWGARC 129

  Fly   181 VPICQDAC-YHGDC-VAPNECRCHPGHEQRLGVPW---ICDPICSSGCANGYC-QGAEVCACKMG 239
            ...|  || .||.| .|...|.|.||        |   .|...|....|...| |....|.||.|
Human   130 EFPC--ACGPHGRCDPATGVCHCEPG--------WWSSTCRRPCQCNTAAARCEQATGACVCKPG 184

  Fly   240 YAHKDNTLASGCEPVCNPPCTNGTCISPGHCACSEGHVFAEGSRHECVPSCRSGCE--NGYCS-S 301
            :..:..:....|.   ..||...:    |.|||..|.         ..|.|:..||  .|.|| :
Human   185 WWGRRCSFRCNCH---GSPCEQDS----GRCACRPGW---------WGPECQQQCECVRGRCSAA 233

  Fly   302 PGRCECHEGFEKTSPHRCSPTCRPG---------CGQNSRCAAPDTCACDVGYVFVNGSTTECEP 357
            .|.|.|..||...   ||...|..|         ||   ||...:.|:.|      .||...|||
Human   234 SGECTCPPGFRGA---RCELPCPAGSHGVQCAHSCG---RCKHNEPCSPD------TGSCESCEP 286

  Fly   358 FCPRNCRNGI-CSSPGVCTCLEGFQALLSFYCIPVCSKTCIHGSCVAPNECRCFTGYRPNPSLGA 421
            ..     ||. |..|    ||.|                                      :.|.
Human   287 GW-----NGTQCQQP----CLPG--------------------------------------TFGE 304

  Fly   422 NVCEPICSQGCVHGFCIAPEICQCDLGFIKR----WATGTCEPHCPQKCVNSHCLGSGVCRCYEG 482
            :     |.|.|.|  |...|.|:.|.|..:|    |....||..||.......|           
Human   305 S-----CEQQCPH--CRHGEACEPDTGHCQRCDPGWLGPRCEDPCPTGTFGEDC----------- 351

  Fly   483 YKLRPGSTSICDPECQPGCRNGTC-VEPNSCACFAGYEDTKVPYECVPSCRPRCENG----RCSS 542
                 |||      | |.|..|:| .....|.|.|||..        |||...|..|    .||.
Human   352 -----GST------C-PTCVQGSCDTVTGDCVCSAGYWG--------PSCNASCPAGFHGNNCSV 396

  Fly   543 PGHCECDPG--HVVTNSSEPNSCRPQCQEQCINAECVAP--------EKCAC 584
            |  |||..|  |.|:.|.:|.|   ..::..:.|..:.|        ..|||
Human   397 P--CECPEGLCHPVSGSCQPGS---GSRDTALIAGSLVPLLLLFLGLACCAC 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimC2NP_001285922.1 None
SCARF1NP_003684.2 CSRNP_N <100..135 CDD:292638 15/72 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 516..539
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 581..688
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 715..830
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.