DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimC2 and TNFAIP6

DIOPT Version :9

Sequence 1:NP_001285922.1 Gene:NimC2 / 34818 FlyBaseID:FBgn0028939 Length:701 Species:Drosophila melanogaster
Sequence 2:NP_009046.2 Gene:TNFAIP6 / 7130 HGNCID:11898 Length:277 Species:Homo sapiens


Alignment Length:178 Identity:38/178 - (21%)
Similarity:53/178 - (29%) Gaps:61/178 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   230 GAEVCAC------KMGYAHKDNTLASGCEPVCNPPCTNGTCISPG-HCACSEGHVFAEGSRHECV 287
            |..|||.      ::||            |:          :.|| :|...:..:...|.|..  
Human    78 GFHVCAAGWMAKGRVGY------------PI----------VKPGPNCGFGKTGIIDYGIRLN-- 118

  Fly   288 PSCRSGCENGYCSSPGRCECHEGFEKTSPHR----------------CSPTCRPGCGQNSRCA-- 334
               ||...:.||.:|...||...|  |.|.:                |....|...||....:  
Human   119 ---RSERWDAYCYNPHAKECGGVF--TDPKQIFKSPGFPNEYEDNQICYWHIRLKYGQRIHLSFL 178

  Fly   335 ---APDTCACDVGYVFVNGSTTECEPFCPRNC----RNGICSSPGVCT 375
               ..|...|...||.:..|..:...|..|.|    .:.|.|:..|.|
Human   179 DFDLEDDPGCLADYVEIYDSYDDVHGFVGRYCGDELPDDIISTGNVMT 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimC2NP_001285922.1 None
TNFAIP6NP_009046.2 Link_domain_TSG_6_like 36..128 CDD:239592 15/76 (20%)
CUB 135..244 CDD:278839 20/94 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.