DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimC2 and tnfaip6

DIOPT Version :9

Sequence 1:NP_001285922.1 Gene:NimC2 / 34818 FlyBaseID:FBgn0028939 Length:701 Species:Drosophila melanogaster
Sequence 2:NP_001035333.2 Gene:tnfaip6 / 678516 ZFINID:ZDB-GENE-060421-2654 Length:271 Species:Danio rerio


Alignment Length:175 Identity:40/175 - (22%)
Similarity:53/175 - (30%) Gaps:60/175 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 ANCTTNCGPLVGRTRTET--YLGFTDVCCDGYIRDENNECVPLCNDCGASGKCLLPNVCLCGKGY 102
            |.|....|.|....:.|.  .:|| .||..|::            |.|..|..::.....||.|.
Zfish    66 AVCNFEGGTLATFDQLEAARQIGF-HVCAAGWL------------DKGRVGYPIVKAGSNCGFGK 117

  Fly   103 VSRKDHGHCEPECSESCVNGKCVAPDECECLAGHRFVNGSQTACEPICVEDCANGRCLETGKCLC 167
            |...|:|:...:.....|  .|..|...||       .|..|..|                |.|.
Zfish   118 VGIIDYGYRLNKSERWDV--YCYNPVAKEC-------GGVHTDPE----------------KVLV 157

  Fly   168 NNGY---QRDEKLKKCVPICQDACYHGDCVAPNECRCHPGHEQRL 209
            :.||   .:||::          ||.       ..|...||..||
Zfish   158 SPGYPDEYQDEQI----------CYW-------HIRVRFGHRIRL 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimC2NP_001285922.1 None
tnfaip6NP_001035333.2 Link_domain_TSG_6_like 46..138 CDD:239592 20/86 (23%)
CUB 145..254 CDD:278839 17/81 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.