DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimC2 and ccbe1

DIOPT Version :9

Sequence 1:NP_001285922.1 Gene:NimC2 / 34818 FlyBaseID:FBgn0028939 Length:701 Species:Drosophila melanogaster
Sequence 2:NP_001157395.1 Gene:ccbe1 / 555629 ZFINID:ZDB-GENE-090506-7 Length:401 Species:Danio rerio


Alignment Length:150 Identity:38/150 - (25%)
Similarity:57/150 - (38%) Gaps:44/150 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 CCDGYIRDENNECVPLCNDCGASGKC-------LLPNVCLCGKGY-VSRKDHGHCE-PECSESCV 120
            ||:|: :....:|:|...|..|...|       ....||.|..|| ..|:.|.:.| |.|.:.  
Zfish    66 CCEGF-KFVLGQCIPEDYDVCAGAPCEQQCTDHFGRVVCTCYDGYRYDRERHRNREKPYCLDI-- 127

  Fly   121 NGKCVAPDECECLAGHRFVNGSQTACEPICVE-------DCANGRCLETGKCLCNNG-----YQR 173
                   |||        .|.::|.|..:||.       ||.:|..||.....|..|     :::
Zfish   128 -------DEC--------ANNNETVCSQMCVNTPGSYRCDCHSGFYLEDDGKTCTKGERAPLFEK 177

  Fly   174 DEKLKK---CVPICQDACYH 190
            .:.:.|   |...|:|  :|
Zfish   178 SDNVMKEGTCSATCED--FH 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimC2NP_001285922.1 None
ccbe1NP_001157395.1 FXa_inhibition 130..166 CDD:291342 11/43 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 229..321
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 344..401
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.