DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimC2 and NimB3

DIOPT Version :9

Sequence 1:NP_001285922.1 Gene:NimC2 / 34818 FlyBaseID:FBgn0028939 Length:701 Species:Drosophila melanogaster
Sequence 2:NP_001033905.1 Gene:NimB3 / 3885611 FlyBaseID:FBgn0054003 Length:122 Species:Drosophila melanogaster


Alignment Length:95 Identity:28/95 - (29%)
Similarity:36/95 - (37%) Gaps:44/95 - (46%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 RTRTETYLGFTDVCCDGYIRDENNECVPLCNDCGASGKCLLPNVCLCGKGYVSRKDHGHCEPECS 116
            |.|..:|      |||||:....::.:                               .|||.||
  Fly    63 RNRQFSY------CCDGYVNKGTSQNL-------------------------------KCEPICS 90

  Fly   117 ESCVNGKCVAPDECECLAGH-------RFV 139
            |.|.||.|:||:||||..|:       |||
  Fly    91 EDCSNGLCLAPEECECAPGYYRSNKRCRFV 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimC2NP_001285922.1 None
NimB3NP_001033905.1 PLN03223 <49..>106 CDD:215637 22/79 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D97941at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.