DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimC2 and CG15861

DIOPT Version :9

Sequence 1:NP_001285922.1 Gene:NimC2 / 34818 FlyBaseID:FBgn0028939 Length:701 Species:Drosophila melanogaster
Sequence 2:NP_001286863.1 Gene:CG15861 / 37990 FlyBaseID:FBgn0035084 Length:205 Species:Drosophila melanogaster


Alignment Length:155 Identity:52/155 - (33%)
Similarity:69/155 - (44%) Gaps:19/155 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   272 CSEGHVFAEGSRHECVPSCRSGCENGYCSSPGRCECHEGFEKTSPHR--CSPTCRPGC-GQNSRC 333
            ||:..:....:| :||..|...|.||.|...|.|.|.:.:...:|..  |:..|.||| .....|
  Fly    36 CSDYEMLVVNTR-QCVRRCNIVCLNGVCFEDGSCPCADQYMAGNPDGLVCAAECLPGCVAAGGYC 99

  Fly   334 AAPDTCAC--DVGYVFVNGSTTECEPFCPR-------NCRNGICSSPGVCTCLEGFQ----ALLS 385
            ||||.|.|  |..|.| :..:.:|....||       .|.:|.|||.|.|.|.:|::    .|..
  Fly   100 AAPDLCVCREDRHYYF-DPLSQKCRHRAPRLLDPCLGRCTHGNCSSDGRCICAQGYELRDSLLHG 163

  Fly   386 FYCIPVCSKTC-IHGSCVAPNECRC 409
            ..|:|:|...| ....|.|||.|.|
  Fly   164 QQCMPICDHNCGPRAYCFAPNLCAC 188



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D97941at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24047
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.