DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimC2 and abu-4

DIOPT Version :9

Sequence 1:NP_001285922.1 Gene:NimC2 / 34818 FlyBaseID:FBgn0028939 Length:701 Species:Drosophila melanogaster
Sequence 2:NP_872210.1 Gene:abu-4 / 353458 WormBaseID:WBGene00000027 Length:339 Species:Caenorhabditis elegans


Alignment Length:381 Identity:76/381 - (19%)
Similarity:125/381 - (32%) Gaps:113/381 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   243 KDNTLASGCEPVCNPPCTNGTCISPGHCACSEGHVFAEGSRHECVPSCRSGCENGYCSSPGRCEC 307
            ::...:.||.|...|           .|:|.: ..:|:..::.|      .|:|   ::|.:..|
 Worm    25 REKRQSCGCAPRVQP-----------SCSCQQ-TTYAQPPQYSC------SCQN---TAPVQTSC 68

  Fly   308 HEGFEKTSPHRCSPTCRPGCGQNSRCAAPDTCACDVGYVFVNGSTTECEPFCPRNCRNGICSSPG 372
                                          :||..|.........::|.|.|.::|:....|:|.
 Worm    69 ------------------------------SCAQPVQQQTYQVQASQCAPACQQSCQMQCQSAPS 103

  Fly   373 VCTCLEGFQALLSFYCIPVCSKTCIHGSCVAPNECRCFTGYRPNPSLGANVCEPICSQGCVHGFC 437
            |..|..            .|.::|...||..|...:|      .||     |.|.|.|.||   .
 Worm   104 VSQCQS------------TCQQSCQASSCYTPAPVQC------QPS-----CMPACKQSCV---A 142

  Fly   438 IAPEICQCDLGFIKRWATGTCEPHCPQKCVNSHCLGSGVCRCYEGYKLRPGSTSICDPECQPGCR 502
            .||:|...:|..:         |.|.|:|. ..|..:...:|.:..........:|..:|.|.|.
 Worm   143 PAPQIISLNLEVV---------PQCQQQCA-PQCQQASAPQCQQCQNTCQQFAPVCQQQCAPQCT 197

  Fly   503 NGTCVEPNSCACFAGYEDTKVPYECVPSCR----PRCE--NGRCSSPGHCECDPGHVVT-----N 556
            ..:..:...|.............:|.|.|:    |:|:  ...|.||.........:||     :
 Worm   198 ISSAPQCQQCQTTCQQFAPVCQQQCAPQCQQPSAPQCQQCQSACQSPVVAPVVAPQIVTVILEAS 262

  Fly   557 SSEPNSCRPQCQEQCINAECVAPEKCACLPRYRFLPDSSTECEPICSKGCLSGQEC 612
            .|:...|.|:||:.| ..:||..::            ...:|.|.|::.|  .|.|
 Worm   263 VSQSAQCEPECQQSC-QQQCVQQQQ------------PMIQCAPACTQSC--SQSC 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimC2NP_001285922.1 None
abu-4NP_872210.1 DUF1096 21..71 CDD:284022 12/96 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.