DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimC2 and NimC4

DIOPT Version :9

Sequence 1:NP_001285922.1 Gene:NimC2 / 34818 FlyBaseID:FBgn0028939 Length:701 Species:Drosophila melanogaster
Sequence 2:NP_609698.2 Gene:NimC4 / 34824 FlyBaseID:FBgn0260011 Length:377 Species:Drosophila melanogaster


Alignment Length:239 Identity:72/239 - (30%)
Similarity:112/239 - (46%) Gaps:27/239 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 CCDGYIRDENNECVPLCN-DCGASGKCLLPNVCLCGKGYVSRKDH----GHCEPECSESCVNG-K 123
            ||.||::.|:..|.|:|: .|.|...|..|:.|.|..||||.::|    .:|||.|...|..| :
  Fly    77 CCPGYLQVESGLCEPICSRGCPAHASCAAPDRCECISGYVSARNHQDGSHYCEPICETPCPAGAQ 141

  Fly   124 CVAPDECECLAGHRFV----NGSQTACEPIC-VED-CANGRCLETGKCLCNNGYQRDEKLKKCVP 182
            ||.|:.|.|..|:..:    :|....|.|:| |.| ||||:|::..:|.||:||:.|:..::|:.
  Fly   142 CVTPNTCACRDGYTQLQPTDDGVSGGCAPVCRVGDGCANGKCIDVDRCACNSGYRWDKAEERCIE 206

  Fly   183 ICQDACYHGDCVAPNECRCHPGHEQRLGVPWICDPICSSGCANGYCQGAEVCACKMGYAHKDNTL 247
            :..::.  .:.:...|............|      ..::.|.:.:......|..|...::....|
  Fly   207 LSAESI--SEELETTEDNTDSPSTSSTAV------FTATHCPDDFVLFRGECREKQFDSNDVGCL 263

  Fly   248 ASGCEPVCNPPCTNGTCISPGHCACSEGHVFAEGSRHECVPSCR 291
            .|||.|       :.||:..|.|.||:|:|..|......|.|||
  Fly   264 KSGCGP-------HQTCLDSGVCQCSDGYVPEESGEATGVLSCR 300



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D97941at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24047
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.