DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimC2 and CG11674

DIOPT Version :9

Sequence 1:NP_001285922.1 Gene:NimC2 / 34818 FlyBaseID:FBgn0028939 Length:701 Species:Drosophila melanogaster
Sequence 2:NP_572948.1 Gene:CG11674 / 32374 FlyBaseID:FBgn0030551 Length:344 Species:Drosophila melanogaster


Alignment Length:367 Identity:83/367 - (22%)
Similarity:116/367 - (31%) Gaps:143/367 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LVLLSGLQVQG---------CVKQAQVVKM-RGTLVTMRKHQNSANCTTN-------CGPLVGRT 53
            |:||:|....|         |...||..:. ||..|.|     :..||..       |.||    
  Fly     9 LLLLAGFLATGRAEDLLELSCSSDAQCAQFERGRCVDM-----ACICTARGSGERVPCTPL---- 64

  Fly    54 RTETYLGFTDVCCDGYIRDENNECVPLCNDCGASGKCLLPNV--------CLCGKGYVSRKDHGH 110
                                 .|.:.|.|..|.:..|.:||.        |.|.:|:||..|...
  Fly    65 ---------------------EERLKLTNIIGGACPCPMPNAICHTRWQQCHCSEGHVSSDDRRR 108

  Fly   111 CEP-------------ECSESCVNGKCVAPDECECLAGHRFVNG-SQTACEPICVED-----CAN 156
            |.|             :|..:.....|:. ::|.||....|..| ..:..:..|:||     |..
  Fly   109 CLPAVVPVGGSCEFQQQCQRADRFSSCIG-NQCLCLNQFEFHEGRCLSVLQSSCLEDKDCGSCGA 172

  Fly   157 GRCL-ETGKCLCNNGYQRDEKLKKCV--PICQDACYH-----------GDCVAPNECRCHPGHE- 206
            ..|| :|.:|.|:..:..:..:.||:  ....|.|.|           |.|: .:.|.|...|. 
  Fly   173 SICLTKTKRCGCSKNFVHNHNMTKCIKGSAYGDTCEHSSPCKLNLGADGRCL-DHLCVCRSTHYP 236

  Fly   207 ---------------------QRLGVPWICDPICSSG--CANGYCQGAEVCACKMGYAHKDNTLA 248
                                 :|:    .|.||...|  |.|.       ..|:|....::|..|
  Fly   237 KRVANEVAKDENDDLDAVNNLERI----TCAPIVPFGALCRND-------SECRMQPMDQENATA 290

  Fly   249 S-GCEPVCNPPCTNGTCISPGHCACSEGH-------VFAEGS 282
            | |...|||          .|.|:||:.|       ||.|.|
  Fly   291 SIGHPMVCN----------WGECSCSKTHRLEDNKCVFVENS 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimC2NP_001285922.1 None
CG11674NP_572948.1 EB 96..153 CDD:279949 14/57 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.