DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimC2 and NimA

DIOPT Version :9

Sequence 1:NP_001285922.1 Gene:NimC2 / 34818 FlyBaseID:FBgn0028939 Length:701 Species:Drosophila melanogaster
Sequence 2:NP_001285918.1 Gene:NimA / 318930 FlyBaseID:FBgn0261514 Length:565 Species:Drosophila melanogaster


Alignment Length:349 Identity:76/349 - (21%)
Similarity:117/349 - (33%) Gaps:111/349 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   409 CFTGYRPNPSLGANVCEPICSQGCVHGFCIAPEICQCDLGFIKRWATGTCEPHCPQKCVNSHCLG 473
            |..||..|.|.....|:|||..||..|.|:.|:||.|:.|:|.:        ||.|:|.:.    
  Fly   112 CCQGYEGNLSDSQATCKPICRGGCGRGSCVMPDICSCEEGYIGK--------HCTQRCDHD---- 164

  Fly   474 SGVCRCYEGYKLRPGSTSICDPECQPGCRNGTCVEPNS--CACFAGYEDTKVPYECVPS-----C 531
                        |.|..  |...||  |:||...:..|  |.|.||:........|...     |
  Fly   165 ------------RWGLD--CKNLCQ--CQNGAACDNKSGLCHCIAGWTGQFCELPCPQGTYGIMC 213

  Fly   532 RPRCENGRCSSPGHCE---CDPGHVVTNSSEPNSCRPQCQEQCINAECV-------APEKCACLP 586
            |..|:         |:   |:|        :..:|..|.|...:|...|       ..||...:|
  Fly   214 RKACD---------CDEKPCNP--------QTGACIQQDQPLQLNVSHVIVETVNSTLEKMGIIP 261

  Fly   587 RYRF---LPDSSTECEP----------------------------------------ICSKGCLS 608
            |...   ||:.....:|                                        :.:.|..|
  Fly   262 RPTTPVPLPEVIVIKQPTSNENAQHSPKIIVHQSSSDLLENLHTAAAAGVPTPEVIHVITNGITS 326

  Fly   609 GQECVAPDTCAGFESLISPTTGKHLAFHWSMFVLAILLCLALVMIPLLVLREMQRRRRNGDKQSS 673
            .||.:     |||....:.::....|.|.|..|:.::..:.|:::.:.| ..:...||...|.::
  Fly   327 PQEHL-----AGFVGGEANSSQTATADHQSGLVVTLVSIMLLLLVAIAV-GSLYVYRRYHHKNAA 385

  Fly   674 RLIENPSYGVVQANSEDTNSELGI 697
            ....|.:...:.||.|...:|..:
  Fly   386 VYNANGTVTTLPANPEVVLTEAAV 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimC2NP_001285922.1 None
NimANP_001285918.1 EMI 52..116 CDD:284877 1/3 (33%)
EGF_2 170..200 CDD:285248 11/31 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.