DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimC2 and Dkk2

DIOPT Version :9

Sequence 1:NP_001285922.1 Gene:NimC2 / 34818 FlyBaseID:FBgn0028939 Length:701 Species:Drosophila melanogaster
Sequence 2:NP_001099942.1 Gene:Dkk2 / 295445 RGDID:1308639 Length:259 Species:Rattus norvegicus


Alignment Length:226 Identity:51/226 - (22%)
Similarity:64/226 - (28%) Gaps:109/226 - (48%)


- Green bases have known domain annotations that are detailed below.


  Fly   299 CSSPGRCE----CHEGFEKTSPHRCSPTCRPGCGQNSRCAAPDTCACDVGYVFVNGSTTECEPFC 359
            |||...||    ||      |||:.|..|.....:..||.....|                   |
  Rat    78 CSSDKECEVGRYCH------SPHQGSSACMVCRRKKKRCHRDGMC-------------------C 117

  Fly   360 P-RNCRNGICSSPGVCTCLEGFQALLSFYCIPVCSKTCIHGSCVAP-------------NECRCF 410
            | ..|.|||                    ||||..      |.:.|             |.    
  Rat   118 PGTRCNNGI--------------------CIPVTE------SILTPHIPALDGTRHRDRNH---- 152

  Fly   411 TGYRPNPSLG-ANVCEP---------------ICSQGCVHGFCIAPEICQCDLGFIKRWATGTCE 459
             |:..|..|| .|:..|               :.|..|:.|||.|           :.:.|..|:
  Rat   153 -GHYSNHDLGWQNLGRPHSKMPHIKGHEGDPCLRSSDCIDGFCCA-----------RHFWTKICK 205

  Fly   460 P--HCPQKCVNSHCLGS-GV-----CRCYEG 482
            |  |..:.|......|| |:     |.|.:|
  Rat   206 PVLHQGEVCTKQRKKGSHGLEIFQRCDCAKG 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimC2NP_001285922.1 None
Dkk2NP_001099942.1 Dickkopf_N 78..128 CDD:398399 21/94 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.