DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimC2 and Dkk1

DIOPT Version :9

Sequence 1:NP_001285922.1 Gene:NimC2 / 34818 FlyBaseID:FBgn0028939 Length:701 Species:Drosophila melanogaster
Sequence 2:NP_001099820.1 Gene:Dkk1 / 293897 RGDID:1307313 Length:270 Species:Rattus norvegicus


Alignment Length:338 Identity:68/338 - (20%)
Similarity:101/338 - (29%) Gaps:146/338 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly   257 PPCTNGTCISPGHC-ACSEGHVFAEGSRHECVPSCRSGCENGYCSSPGRCECHEGFEKTSPHRCS 320
            ||...|....||.. :.:.|.::..|::::.:        :.|...|    |.|..|        
  Rat    47 PPPLGGAGGQPGSAVSVAPGVLYEGGNKYQTL--------DNYQPYP----CAEDEE-------- 91

  Fly   321 PTCRPGCGQNSRCAAPDTCACDVGYVFVNGSTTECEPFCPRNCRNGICSSPGVCTCLEGFQALLS 385
                  ||.:..|::|...|..||                           ||..||        
  Rat    92 ------CGTDEYCSSPSRGAAGVG---------------------------GVQICL-------- 115

  Fly   386 FYCIPVC---SKTCI-HGSCVAPNECRCFTGYRPNPSLGANVCEPICSQGCVHGFCIAPEICQCD 446
                 .|   .|.|: |..|...|.|:                         :|.|:     ..|
  Rat   116 -----ACRKRRKRCMRHAMCCPGNYCK-------------------------NGICM-----PSD 145

  Fly   447 LGFIKRWATGTCEPHCPQKCVNSHCLGSGVCRCYEGYKLRPGSTS-ICDPECQPGCRNGTCVEPN 510
            ...:.|   |..|....:...|.|  |:|     :||..|...|| |...:.|.|   ..|:..:
  Rat   146 HSHLPR---GEIEEGIIENLGNDH--GAG-----DGYPRRTTLTSKIYHTKGQEG---SVCLRSS 197

  Fly   511 SCA---CFAGYEDTKVPYECVPSCRPRCENG-------RCSSPG-----HCECDPG--------- 551
            .||   |.|.:..:|:       |:|..:.|       |..|.|     .|.|..|         
  Rat   198 DCATGLCCARHFWSKI-------CKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLACRIQKDH 255

  Fly   552 HVVTNSSEPNSCR 564
            |..:|||..::|:
  Rat   256 HQTSNSSRLHTCQ 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimC2NP_001285922.1 None
Dkk1NP_001099820.1 Dickkopf_N 86..142 CDD:398399 22/134 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.