DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimC2 and NimB2

DIOPT Version :9

Sequence 1:NP_001285922.1 Gene:NimC2 / 34818 FlyBaseID:FBgn0028939 Length:701 Species:Drosophila melanogaster
Sequence 2:NP_723857.1 Gene:NimB2 / 260645 FlyBaseID:FBgn0028543 Length:421 Species:Drosophila melanogaster


Alignment Length:343 Identity:115/343 - (33%)
Similarity:160/343 - (46%) Gaps:66/343 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 FVNGSQTA-CEPICVEDCANGRCLETGK---------------CLCNNGYQRDEKL-KKCVPICQ 185
            |:|.:::| ...:|.::......|...:               .:|.:||:|:..: ::|.|||.
  Fly   122 FINKTRSAMASGVCYKEVPTASLLRNSRDQFVGNGTTPDMSRIQVCCDGYERNPHIYRRCEPICA 186

  Fly   186 DACYHGDCVAPNECRCHPGHEQRLGVPWICDPICSSGCANGYCQGAEVCACKMGYAHKDNTLASG 250
            |.|.:|.|.|||.|.|.|||.:.  ....|...|..||.||.|.....|.|:.||:.:..| ...
  Fly   187 DDCRNGICTAPNTCVCIPGHVRT--AEGKCISTCPLGCGNGVCDERNECKCREGYSLEPET-RKY 248

  Fly   251 CEPVCNPPCTNGTCISPGHCACSEGH-VFAEGSRHECVPSCRSGCENGYCSSPGRCECHEGFEKT 314
            |:|.|.|.|:.|.|::|..|||.:|: :.|:||   |.|.|.| ||||.|::||.|.        
  Fly   249 CQPECKPGCSFGRCVAPNKCACLDGYRLAADGS---CEPVCDS-CENGKCTAPGHCN-------- 301

  Fly   315 SPHRCSPTCRPGCGQNSRCAAPDTCACDVGYVFVNGSTTECEPFCPRNCRNGICSSPGVCTCLEG 379
                                      |:.||:.:.|   .|||.|...|:||.|..|.:|.|..|
  Fly   302 --------------------------CNAGYLKLQG---RCEPICSIPCKNGRCIGPDICECASG 337

  Fly   380 FQ-ALLSFYCIPVCSKTCIHGSCVAPNECRCFTGYRPNPSLGANVCEPICSQGCVHGFCIAPEIC 443
            |: ...|..|:|.|...|::|.||..|:|.|.||| .......|:|:|.|.|||.:|:|.||..|
  Fly   338 FEWDRKSAECLPKCDLPCLNGVCVGNNQCDCKTGY-VRDEHQRNICQPHCPQGCQNGYCSAPNFC 401

  Fly   444 QCDLGFIKRWATG--TCE 459
            .|..||||....|  ||:
  Fly   402 ICRPGFIKSGIKGRQTCQ 419



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D16493at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24047
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.