Sequence 1: | NP_001285922.1 | Gene: | NimC2 / 34818 | FlyBaseID: | FBgn0028939 | Length: | 701 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_663567.1 | Gene: | Dkk4 / 234130 | MGIID: | 2385299 | Length: | 221 | Species: | Mus musculus |
Alignment Length: | 241 | Identity: | 53/241 - (21%) |
---|---|---|---|
Similarity: | 81/241 - (33%) | Gaps: | 86/241 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 384 LSFYCIPVC----------SKTCIHGS-----CVAPNECR----CFTGYRPNPSLGANV------ 423
Fly 424 CE--PICSQG--CVHGFCIA-----PEICQCDLGFIKRWATGT----CEPHCPQKCVNSHCLGSG 475
Fly 476 VCRCYEGYKLRPGSTSICDPECQPGCRNGTCVEPNSCACFAGYEDTKVPYECVPSCRPRCENGR- 539
Fly 540 CSSPGH------------CECDPGHVVTNSSEPNSCRPQ-----CQ 568 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
NimC2 | NP_001285922.1 | None | |||
Dkk4 | NP_663567.1 | Dickkopf_N | 41..91 | CDD:368068 | 10/50 (20%) |
DKK-type Cys-1 | 41..90 | 10/49 (20%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 101..143 | 9/49 (18%) | |||
DKK-type Cys-2 | 145..218 | 22/93 (24%) | |||
Prokineticin | <145..202 | CDD:148298 | 18/77 (23%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1218 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |