DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimC2 and DKK1

DIOPT Version :9

Sequence 1:NP_001285922.1 Gene:NimC2 / 34818 FlyBaseID:FBgn0028939 Length:701 Species:Drosophila melanogaster
Sequence 2:NP_036374.1 Gene:DKK1 / 22943 HGNCID:2891 Length:266 Species:Homo sapiens


Alignment Length:274 Identity:57/274 - (20%)
Similarity:78/274 - (28%) Gaps:117/274 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   257 PPCTNGTCISPGHC-ACSEGHVFAEGSRHECVPS-----CRSGCENG---YCSSPGR-------- 304
            ||...|....||.. :.:.|.::..|::::.:.:     |....|.|   ||:||.|        
Human    46 PPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQI 110

  Fly   305 CECHEGFEKTSPHRCSPTCRPGCGQNSRCAAPDTCACDVGYVFVNGSTTECEPFCPRN-CRNGIC 368
            |               ..||.   :..||.....|                   ||.| |:||||
Human   111 C---------------LACRK---RRKRCMRHAMC-------------------CPGNYCKNGIC 138

  Fly   369 SSPGVC--------TCLEGFQALLSFYCIPVCSKTCIHGSCVAPNECRCFTGYRPNPSLGA---- 421
            .|....        |..|.|                       .|:.....||....:|.:    
Human   139 VSSDQNHFRGEIEETITESF-----------------------GNDHSTLDGYSRRTTLSSKMYH 180

  Fly   422 ------NVCEPICSQGCVHGFCIAPEICQCDLGFIKRWATGTCEPHCP--QKCVNSHCLGS-GV- 476
                  :||  :.|..|..|.|.|...          |:. .|:|...  |.|......|| |: 
Human   181 TKGQEGSVC--LRSSDCASGLCCARHF----------WSK-ICKPVLKEGQVCTKHRRKGSHGLE 232

  Fly   477 ----CRCYEGYKLR 486
                |.|.||...|
Human   233 IFQRCYCGEGLSCR 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimC2NP_001285922.1 None
DKK1NP_036374.1 Dickkopf_N 85..139 CDD:309719 21/90 (23%)
DKK-type Cys-1 85..138 20/89 (22%)
DKK-type Cys-2 189..263 19/71 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.