DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimC2 and VWDE

DIOPT Version :9

Sequence 1:NP_001285922.1 Gene:NimC2 / 34818 FlyBaseID:FBgn0028939 Length:701 Species:Drosophila melanogaster
Sequence 2:XP_011513476.1 Gene:VWDE / 221806 HGNCID:21897 Length:1710 Species:Homo sapiens


Alignment Length:358 Identity:111/358 - (31%)
Similarity:154/358 - (43%) Gaps:92/358 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 NECVPLCN-DCGASGKCLLPNVCLCGKGYV-SRKDHGHCEPECSESCVNGKCVAPDECECLAGHR 137
            |..:.:|. .||.|.:|:.||:|.|..||: |......|:|:|..   :|||:.|:.|:||.||.
Human  1412 NLSLAICKYPCGKSRECVAPNICKCKPGYIGSNCQTALCDPDCKN---HGKCIKPNICQCLPGHG 1473

  Fly   138 FVNGSQTACEPICVEDCANGRCLETGKCLCNNGY--QRDEKLKKCVPICQDACYH-GDCVAPNEC 199
            .....:..|.|.|..   .|.||....|.|..|:  .|.|.:     :|...|.: |.|:.|:.|
Human  1474 GATCDEEHCNPPCQH---GGTCLAGNLCTCPYGFVGPRCETM-----VCNRHCENGGQCLTPDIC 1530

  Fly   200 RCHPGHEQRLGVPW--------ICDPICSSGCANGYCQGAEVCACKMGY--AHKDNTLASGCEPV 254
            :|.||        |        :|||:|.:|   |.|.....|.|..|:  .|..|..       
Human  1531 QCKPG--------WYGPTCSTALCDPVCLNG---GSCNKPNTCLCPNGFFGEHCQNAF------- 1577

  Fly   255 CNPPCTNGTCISPGHCACSEGHVFAEGSRHECVPSCRSGCENGYCSSPGRCECHEGFEKTSPHRC 319
            |:|||.||     |||.          ..:.||      |..||   .||     .|:|:.   |
Human  1578 CHPPCKNG-----GHCM----------RNNVCV------CREGY---TGR-----RFQKSI---C 1610

  Fly   320 SPTCRPGCGQNSRCAAPDTCACDVGYVFVNGSTTECE-PFCPRNCRN-GICSSPGVCTCLEGFQA 382
            .|||..|    .:|..|.||:|..|:     |...|. |.|.:.|:| |.|.:|.:|.|...::.
Human  1611 DPTCMNG----GKCVGPSTCSCPSGW-----SGKRCNTPICLQKCKNGGECIAPSICHCPSSWEG 1666

  Fly   383 LLSFYC-IPVCSKTCIHGS-CVAPNECRCFTGY 413
            :   .| ||:|:..|::|. |:.||.|.|.|.|
Human  1667 V---RCQIPICNPKCLYGGRCIFPNVCSCRTEY 1696

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimC2NP_001285922.1 None
VWDEXP_011513476.1 VWD 423..581 CDD:295339
EGF_CA 1255..1293 CDD:214542
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R9097
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.