DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimC2 and C53B7.2

DIOPT Version :9

Sequence 1:NP_001285922.1 Gene:NimC2 / 34818 FlyBaseID:FBgn0028939 Length:701 Species:Drosophila melanogaster
Sequence 2:NP_509154.2 Gene:C53B7.2 / 183744 WormBaseID:WBGene00016893 Length:169 Species:Caenorhabditis elegans


Alignment Length:241 Identity:46/241 - (19%)
Similarity:64/241 - (26%) Gaps:120/241 - (49%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 TDVCCDGYIRDENNECVPLCNDCGASGKCLLPNVCLCGKGYVSRKDHGHCEPECSESCVNGKCVA 126
            |.|.|.  |.::.:.|..:|     ...|..||                  |:|...|..     
 Worm    25 TQVSCG--INEQYSPCTQMC-----PPTCESPN------------------PQCRVDCTR----- 59

  Fly   127 PDECECLAGHRFVNGSQTACEPICVEDCANGRCLETGKCLCNNGYQRDEKLKKCVPICQDACYHG 191
             ..|.||.||.:.|..|                                    |:|  .::||..
 Worm    60 -PSCTCLPGHVYSNSRQ------------------------------------CIP--ANSCYQT 85

  Fly   192 D---CVAPNECRCHPGHEQRLGVPWICDPICSSGCANGYCQGA------------EVCACKMGYA 241
            .   |...|:||  ||                ..|.||||..|            .:.:...|:.
 Worm    86 QSLRCRMNNDCR--PG----------------MYCINGYCGAASGVYTRTVVSSSSLSSSSSGHR 132

  Fly   242 HKDNTLASGCEPVCNPPCTNGTCISPGHC----ACSEG-HVFAEGS 282
            |..:.             :.|.|....||    .|.:| .|:|:.|
 Worm   133 HHSHR-------------SQGECSLDVHCDHRKICIDGICVYADRS 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimC2NP_001285922.1 None
C53B7.2NP_509154.2 TIL 29..82 CDD:366828 19/121 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.