DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp28a5 and CYP71A27

DIOPT Version :9

Sequence 1:NP_609694.1 Gene:Cyp28a5 / 34817 FlyBaseID:FBgn0028940 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_193757.3 Gene:CYP71A27 / 827771 AraportID:AT4G20240 Length:451 Species:Arabidopsis thaliana


Alignment Length:475 Identity:98/475 - (20%)
Similarity:180/475 - (37%) Gaps:115/475 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVLITLTLVSLVVGLLYAVLVWNYDYWRKRGVPGPKPKL--------LCGNYPNMFTMKRHAIYD 57
            |:||:|.|.:|:..|....|:       || :...||||        :.||...:.......::.
plant     3 MILISLCLTTLLAFLFLKPLL-------KR-ITTTKPKLPPSPWRLPVIGNLHQLGPNPHRYLHS 59

  Fly    58 LDDIYRQYKNKYDAVGI--FGSRSPQLLVINPALARRVFVSNFKNFHDNEIAKNIDEKTDFIFAN 120
            |       ..:|..:.:  || |.|.|:|..|.:.             |:|.|..|.|    |||
plant    60 L-------SLRYGPLMLLHFG-RVPVLVVSCPDVT-------------NDIMKTHDLK----FAN 99

  Fly   121 NP----------------FSLTGEKWKTRRADVTPGLTMGRIKTVYPVTNKVCQKLTEWVEKQLR 169
            .|                |...||.||          :|..:..|:.:.||:.:......|::::
plant   100 RPKSKAINIFMEGGRDIIFGPYGEDWK----------SMKSLGVVHLLNNKMVRSFENLREEEIK 154

  Fly   170 L---------GSKDGIDAKHMSLCFTTEMVTDCVLGLGAESFSDKPTPIMSKINDLFNQPWTFVL 225
            :         .|...::...:.:..|.:::  |.:.|| ..::::...|     |:.|...|...
plant   155 VMTEKLEEASSSSSSVNLSKLLMTLTNDII--CRITLG-RKYNEEEGGI-----DIKNLVMTSSE 211

  Fly   226 F---FILTSSFPSLSHL-------IKLRFVPVDVERFFVDLMGSAVETRRAQLAAGKQFERSDFL 280
            |   |......|||:.:       .|::.:...::.|...::...|:....        |.|||:
plant   212 FFGKFFFGDFIPSLAWIDWISGIDDKMKDINNKLDCFLDSMVQEHVDADHK--------EPSDFI 268

  Fly   281 DYILQLGEKR----NLDNRQLLAYSMTFLLDGFETTATVLAHILLNLGRNKEAQNLLREEIRSHL 341
            |.:|.:.:.:    ..|...|:.........|..|||:.|...:..|.|:.|....|::||.|..
plant   269 DMLLLIQKDKTKRFKFDRSDLILILKDMFFSGTATTASQLEWTMTELMRHPECMKKLQDEINSFS 333

  Fly   342 QDGTIAFEK-LSDLPYLDACVQETIRLFPPGFMSNKLCTESIEIPNKEGPNFVVEKGTTVVVPHY 405
            .......|| :..:.||...::|.:||.|.|.:..:|.:|.:::     ..:.:..||.|::..:
plant   334 THNLNVTEKEVEKMNYLHCVIKEGLRLHPSGPLLFRLPSEDVQL-----KGYDISAGTHVIINAW 393

  Fly   406 CFMLDEEFFP-NPQSFQPER 424
            ....:...:. :...::|||
plant   394 ALQRNPAIWGLDANEYRPER 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp28a5NP_609694.1 p450 33..500 CDD:299894 88/443 (20%)
CYP71A27NP_193757.3 p450 33..439 CDD:299894 85/437 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D467733at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.