DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp28a5 and AT3G32047

DIOPT Version :9

Sequence 1:NP_609694.1 Gene:Cyp28a5 / 34817 FlyBaseID:FBgn0028940 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_001030796.1 Gene:AT3G32047 / 3769237 AraportID:AT3G32047 Length:502 Species:Arabidopsis thaliana


Alignment Length:445 Identity:94/445 - (21%)
Similarity:166/445 - (37%) Gaps:118/445 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 YRQYKNKYDAVGIFGSRSPQLLVINPALARRVFVSNFKNFHDNEIAKNIDEKTDFIFANNPFSLT 126
            |.:...|.....:||.::.:.|       |.|.....:.||.|.::|.:..:|..| |.....||
plant   134 YWRLMKKLMVTKLFGPQALERL-------RHVREDELERFHTNLLSKEMKGETVQI-AKEAIKLT 190

  Fly   127 GEKWKTRRADVTPGLTMGRIKTVYPVTNKVCQKLTEWVEKQLRLG----SKDGIDAKHMSLCFTT 187
                                      .|.||:.:         :|    .::|..|:        
plant   191 --------------------------NNSVCKMI---------MGRSCLEENGDAAR-------- 212

  Fly   188 EMVTDCVLGLGAESFSDKPTPIMSKINDLFNQPWTFVLFFILTSSFPSLSHLIKLRFVPVDVERF 252
                  |.||..|:|:     ::.||                     .|:.:::..|..:.:..|
plant   213 ------VRGLVTETFA-----LVKKI---------------------FLTQVLRRLFEILGISLF 245

  Fly   253 FVDLMGSA------VETRRAQLAAGKQFERSDFLDYILQLGEKRNLDNRQLLAYSMT-------- 303
            ..:::|.:      :|....:......|:..|.:|.:|......|.:      |.:|        
plant   246 KKEILGVSRKFDEFLEKILVEHDEKPDFQGGDMMDVLLAAYRDENAE------YKITRNHIKSLF 304

  Fly   304 --FLLDGFETTATVLAHILLNLGRNKEAQNLLREEIRSHLQDGTIAFEK-LSDLPYLDACVQETI 365
              .:|.|.:|:|..:...:..:.........||:|:.|.:....:..|| |.:||||.:.|:|.:
plant   305 AELILGGTDTSAQTIEWTMAEIINKPNILEKLRKELDSVVGKTRLIEEKDLPNLPYLQSVVKEGL 369

  Fly   366 RLFPPGFMSNKLCTESIEIPNKEGPNFVVEKGTTVVVPHYCFMLDEEFFPNPQSFQPERFLEPDA 430
            ||.||..:..:...|...|     ..:.|.|.|.:||..|..|.|..::.:|..|:|||||...:
plant   370 RLHPPAPVFGRKVLEGCTI-----KGYYVPKNTALVVNAYAVMRDPHYWEDPDEFKPERFLTTSS 429

  Fly   431 AK-TFRERGV-FMGFGDGPRVCIGMRFATVQIKAAIVELISKFNVKI-NDKTRKD 482
            .| ..||:.: ::.||.|.|.|.|:....:.:..||..::..|:.:: .||...|
plant   430 KKEEEREQELKYIPFGSGRRGCPGVNLGYIFVGTAIGMMVHCFDWRVKGDKVNMD 484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp28a5NP_609694.1 p450 33..500 CDD:299894 94/445 (21%)
AT3G32047NP_001030796.1 p450 59..496 CDD:299894 94/445 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D467733at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.