DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp28a5 and CYP705A28

DIOPT Version :9

Sequence 1:NP_609694.1 Gene:Cyp28a5 / 34817 FlyBaseID:FBgn0028940 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_001154631.1 Gene:CYP705A28 / 3768880 AraportID:AT3G20935 Length:348 Species:Arabidopsis thaliana


Alignment Length:321 Identity:85/321 - (26%)
Similarity:138/321 - (42%) Gaps:57/321 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   194 VLGLGAESFSDKPTPIMSKINDLFNQPWTFVLFFILTSSFPSLSHLIKLRFVPVDVERFFVDLMG 258
            |.||..||.:..|...:..|   |::|...:...:......|:|.    :|..: :|:|.|:   
plant    17 VRGLVIESLALSPKIFLGMI---FHKPLKKLGISLFQKDIKSVSP----KFDEL-LEKFLVE--- 70

  Fly   259 SAVETRRAQLAAGKQFERSDFLDYILQLGEKR----NL----------------------DNRQL 297
                  ..:......::.:|.:|.:|:..|.|    ||                      .|..|
plant    71 ------HEEKMEEDHYKANDMMDLLLEAMEMRMQNVNLCIKRVSNTKARKPPILFRYGKYSNNSL 129

  Fly   298 LAYSMTFLLDGFETTATVLAHILLNLGRNKEAQNLLREEIRSHLQDGTIAFE-KLSDLPYLDACV 361
            |...:  |:.|.:|:|......:..|..|......|||||.|.:.:..:..| .||:||||.:.|
plant   130 LLQEL--LVAGTDTSALATQWTMAELINNPTILERLREEIESVVGNTRLIQETDLSNLPYLQSVV 192

  Fly   362 QETIRLFPPGFMSNKLCTESIEIPNKEGPNFVVEKGTTVVVPHYCFMLDEEFFPNPQSFQPERFL 426
            :|.:||.||..:|.::..|..|:    |..::.|| |.:||..|..|.|..|:.:|:.|:||||:
plant   193 KEGLRLHPPASISVRMSQERCEL----GGFYIPEK-TLLVVNTYAIMRDPNFWEDPEEFKPERFI 252

  Fly   427 EPDAAK---TFRERGV-FMGFGDGPRVCIGMRFATVQIKAAIVELISKFNVKINDKTRKDN 483
            ....::   ..||..: ::.|..|.|.|.|...|.|.:..||..::..|:.:|  |..|.|
plant   253 TSSRSEQEDEMREEVLKYIPFSAGRRGCPGSNLAYVSLGIAIGVMVQCFDWRI--KGEKVN 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp28a5NP_609694.1 p450 33..500 CDD:299894 85/321 (26%)
CYP705A28NP_001154631.1 p450 <13..346 CDD:299894 85/321 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D467733at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.